SHMEKIIKEKISSLLSQEEEVLSVEQLGGMTNQNYLAKTTNKQYIVKFFGKGTEKLINRQDEKYNLELLKDLGLDVKNYL
FDIEAGIKVNEYIESAITLDSTSIKTKFDKIAPILQTIHTSAKELRGEFAPFEEIKKYESLIEEQIPYANYESVRNAVFS
LEKRLADLGVDRKSCHIDLVPENFIESPQGRLYLIDWEYSSMNDPMWDLAALFLESEFTSQEEETFLSHYESDQTPVSHE
KIAIYKILQDTIWSLWTVYKEEQGEDFGDYGVNRYQRAVKGLASYG
The query sequence (length=286) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4r78:A | 287 | 286 | 1.0000 | 0.9965 | 1.0000 | 0.0 | 4r7b:A, 4r7b:B |
2 | 6yxs:A | 359 | 335 | 0.2413 | 0.1922 | 0.2060 | 5.30e-06 | 3fi8:A, 6yxt:A |
3 | 7s3l:A | 254 | 154 | 0.1643 | 0.1850 | 0.3052 | 1.56e-05 | |
4 | 3c5i:D | 355 | 328 | 0.2413 | 0.1944 | 0.2104 | 0.004 | 3c5i:C, 3c5i:A, 3c5i:B |
5 | 4pdy:A | 332 | 63 | 0.0734 | 0.0633 | 0.3333 | 0.008 | |
6 | 3mes:B | 358 | 145 | 0.1119 | 0.0894 | 0.2207 | 0.23 | 3mes:A |
7 | 3wub:A | 313 | 69 | 0.0629 | 0.0575 | 0.2609 | 0.46 | 3wue:A, 3wuf:A, 3wug:A |
8 | 3s1e:A | 499 | 76 | 0.0629 | 0.0361 | 0.2368 | 0.79 | 3bw7:A, 3c0p:A, 3dq0:A, 3kjm:A, 2qkn:A, 2qpm:A, 3s1c:A, 3s1d:A, 3s1f:A, 1w1o:A, 1w1q:A, 1w1r:A, 1w1s:A |
9 | 3lq3:A | 339 | 160 | 0.1294 | 0.1091 | 0.2313 | 0.90 | 3feg:A |
10 | 1nw1:A | 365 | 305 | 0.2343 | 0.1836 | 0.2197 | 0.98 | 1nw1:B |
11 | 8pm4:A | 604 | 77 | 0.0699 | 0.0331 | 0.2597 | 4.9 | |
12 | 1uqw:A | 487 | 148 | 0.1049 | 0.0616 | 0.2027 | 5.2 | 1uqw:B |
13 | 7w7g:B | 1711 | 72 | 0.0664 | 0.0111 | 0.2639 | 5.4 | |
14 | 4c2v:B | 281 | 76 | 0.0874 | 0.0890 | 0.3289 | 5.7 | 4b8l:A, 4b8m:A, 4b8m:B, 2bfy:A, 2bfy:B, 4c2v:A, 4c2w:A, 4c2w:B, 5eyk:A, 5eyk:B, 5k3y:A, 5k3y:B, 2vgo:A, 2vgo:B, 2vgp:A, 2vgp:B, 2vrx:A, 2vrx:B, 3ztx:A, 3ztx:B |
15 | 4pxg:A | 466 | 130 | 0.1259 | 0.0773 | 0.2769 | 5.9 | 2reu:A, 7xm0:A, 7xm0:B, 7xm0:C |
16 | 8tci:A | 283 | 57 | 0.0664 | 0.0671 | 0.3333 | 9.4 | 8tci:D |