SHHHHHHSDQMVKYFLGQSVLRSSWDQVFAAFWQRYPNPYSKHVLTEDIVHREVTPDQKLLSRRLLTVTNRMPRWAERLF
PANVAHSVYVLEDSIVDPQNQTMTTFTWNINHARLMVVEERSVYSVNSDNSGWTEIRREAWVSSSLFGVSRAVQEFGLAR
FKSNVTKTMKGFEYILAKLQGE
The query sequence (length=182) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6i3y:F | 182 | 182 | 1.0000 | 1.0000 | 1.0000 | 6.04e-137 | 6i3y:C |
2 | 6kyl:D | 160 | 159 | 0.2747 | 0.3125 | 0.3145 | 8.53e-25 | 6kyl:B |
3 | 7szp:A | 353 | 29 | 0.0714 | 0.0368 | 0.4483 | 2.8 | 7szp:B, 7szp:C, 7szp:D |
4 | 7wyz:B | 294 | 31 | 0.0495 | 0.0306 | 0.2903 | 3.8 | 5avz:B, 5aw3:B, 7wyz:D, 7wz0:B, 7wz0:D, 7y45:D, 7y45:B, 7y46:D, 7y46:B |
5 | 5z49:B | 220 | 43 | 0.0769 | 0.0636 | 0.3256 | 5.3 | 5z49:A |
6 | 8hi6:A | 534 | 36 | 0.0714 | 0.0243 | 0.3611 | 7.4 | |
7 | 2vd5:A | 390 | 64 | 0.0879 | 0.0410 | 0.2500 | 9.2 | 2vd5:B |