BioLiP

>protein
SHHHHHHGSTYDFTGNTPPPAPQGMKWVKISQLSDEFNNGFNTDKWTKSLWNYGVPVQMKAENSGVSDGKLWIKATLGND
PERWFETSRVMSKAQVNYPMYTVSRIKGAHISAYNTFWLNNGNISNRNEIDVIENNSNPSCNCQPDFPWQMNSQYFHVVN
DDTKRNKGNFDNRELSDANPLKGVAWNEEYHTFGVWWKDATHIQFYLDGEPAGSVVSARDFTRELNIIWDLWTVDADWLG
GLAKKEHLSNNNINTMKIDWIHTYQLVEE

The query sequence (length=269) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6hy3:A	269	269	1.0000	1.0000	1.0000	0.0
2	3ilf:A	257	266	0.3086	0.3230	0.3120	2.26e-30	4ate:A
3	4awd:A	297	285	0.2937	0.2660	0.2772	7.05e-18	4awd:B
4	6aii:A	330	323	0.3011	0.2455	0.2508	1.38e-12
5	7fgz:A	260	222	0.2193	0.2269	0.2658	5.31e-12
6	4atf:C	297	304	0.2900	0.2626	0.2566	5.73e-12	4atf:A, 4atf:B, 4atf:D
7	1o4y:A	270	280	0.2565	0.2556	0.2464	2.35e-08	1urx:A
8	5ocq:B	279	96	0.1115	0.1075	0.3125	0.006	5ocq:A
9	9int:A	282	261	0.2342	0.2234	0.2414	0.031
10	5ub4:B	279	105	0.0929	0.0896	0.2381	0.34	5ub4:A, 5ub6:A, 5ub6:B, 5ub7:A, 5ub7:B
11	8xph:A	254	84	0.0929	0.0984	0.2976	0.60	8xph:B, 8xpk:A, 8xpk:B
12	4asm:B	357	125	0.1004	0.0756	0.2160	0.77
13	8ep4:A	265	223	0.2193	0.2226	0.2646	2.0	8ep4:B, 8ep4:C, 8ew1:A, 8ew1:B, 8ew1:C
14	5h92:B	572	68	0.0706	0.0332	0.2794	2.3	5h8v:A, 5h8v:B, 5h8y:A, 5h8y:B, 5h8y:C, 5h8y:D, 5h92:A
15	6of2:B	528	28	0.0483	0.0246	0.4643	3.3	6of2:E, 6of3:B, 6of3:E
16	7qh8:A	471	49	0.0558	0.0318	0.3061	3.6	7qhn:A, 7qi8:A
17	5hq4:A	662	169	0.1524	0.0619	0.2426	4.2	5hqa:A, 5hqb:A, 5hqc:A
18	7ysh:B	179	46	0.0483	0.0726	0.2826	5.5	2p39:A, 7ysu:B, 7ysw:B
19	8wm7:C	658	21	0.0409	0.0167	0.5238	7.7	8w9m:C

[Back]