SGSPLAQQIKNILSLISQADAAGRMDEVRTLQLNLCQLMVEYFQQGSPLAQQIKNIHSFGHQAWAAGRLDEVLTIQENLY
QLMKEYFQQS
The query sequence (length=90) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7bww:A | 90 | 90 | 1.0000 | 1.0000 | 1.0000 | 5.93e-63 | 7bww:B, 7bww:C, 7bww:D, 6ypi:A |
2 | 5od9:A | 95 | 94 | 0.7222 | 0.6842 | 0.6915 | 8.68e-37 | 5od1:A, 5od9:B |
3 | 3v1d:A | 48 | 45 | 0.4222 | 0.7917 | 0.8444 | 7.30e-22 | 3v1c:A, 3v1c:B, 3v1d:F, 3v1d:B, 3v1d:C, 3v1d:E, 3v1d:H, 3v1d:D, 3v1d:G, 3v1e:A, 3v1e:B, 3v1f:A, 3v1f:B |
4 | 3v1d:A | 48 | 45 | 0.4222 | 0.7917 | 0.8444 | 7.11e-20 | 3v1c:A, 3v1c:B, 3v1d:F, 3v1d:B, 3v1d:C, 3v1d:E, 3v1d:H, 3v1d:D, 3v1d:G, 3v1e:A, 3v1e:B, 3v1f:A, 3v1f:B |
5 | 7k7m:B | 757 | 59 | 0.2333 | 0.0277 | 0.3559 | 0.83 | 7k7m:A, 7n6b:A |
6 | 6aji:A | 873 | 59 | 0.2333 | 0.0241 | 0.3559 | 0.86 | |
7 | 6ajf:A | 901 | 59 | 0.2333 | 0.0233 | 0.3559 | 0.89 | 6ajg:A, 6ajh:A, 6ajj:A, 7c2m:A, 7c2n:A, 6or2:A, 7wnx:A |
8 | 2bbr:A | 189 | 42 | 0.1889 | 0.0899 | 0.4048 | 1.9 | |
9 | 1gxo:A | 320 | 33 | 0.1333 | 0.0375 | 0.3636 | 8.6 | |
10 | 3hzl:A | 394 | 27 | 0.1222 | 0.0279 | 0.4074 | 9.7 | 2oln:A, 2olo:A, 2q6u:A |