SGPRLNTDYTSANQDSRVQFIVLHYTSTDLPHSLGILTHGGVSAHYLIGDDEPATVYRLVDENRRAWHAGVSEWQGRTWL
NATSIGIEIVNQGYRDTPQGRVWYPFSEAQIQALIPLLKDIAKRHGITPDRIIGHSDIAPGRKVDPGPLFPWKRLADAGL
VPWPKPGELARRLAELNGQLPDVRWFQQQLARHGYLVPQTGELEKDTRDVIGAFQMKYRPARFDGEPDLETAALLLAVPT
S
The query sequence (length=241) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4bol:A | 243 | 241 | 1.0000 | 0.9918 | 1.0000 | 2.12e-179 | 4bol:B, 4bpa:B |
2 | 3d2y:A | 257 | 244 | 0.4315 | 0.4047 | 0.4262 | 5.24e-57 | 2bh7:A, 3d2z:A, 2wkx:A |
3 | 4bxd:A | 255 | 252 | 0.4357 | 0.4118 | 0.4167 | 8.75e-47 | 4bxd:B, 4bxe:A, 4bxe:B |
4 | 1j3g:A | 187 | 125 | 0.2033 | 0.2620 | 0.3920 | 1.59e-18 | 2y28:A, 2y28:B, 2y28:C, 2y2b:A, 2y2b:B, 2y2b:C, 2y2d:A, 2y2d:B, 2y2d:C, 2y2e:A, 2y2e:B, 2y2e:C |
5 | 5x9u:A | 494 | 104 | 0.1203 | 0.0587 | 0.2788 | 0.024 | 5x9u:B, 5x9u:C, 5x9u:D, 5x9v:A, 5x9v:B, 5x9v:C, 5x9v:D |
6 | 3hmb:B | 156 | 94 | 0.1120 | 0.1731 | 0.2872 | 0.23 | 3hmb:A, 3hmb:C, 3rdr:A |
7 | 2nom:B | 255 | 114 | 0.1120 | 0.1059 | 0.2368 | 0.56 | |
8 | 1lqa:A | 346 | 85 | 0.0913 | 0.0636 | 0.2588 | 0.60 | 1lqa:B |
9 | 5o2w:A | 248 | 50 | 0.0705 | 0.0685 | 0.3400 | 1.7 | 5o2x:A |
10 | 1wqa:A | 455 | 91 | 0.0996 | 0.0527 | 0.2637 | 2.3 | 1wqa:B, 1wqa:C, 1wqa:D |
11 | 6y0r:AAA | 468 | 113 | 0.1328 | 0.0684 | 0.2832 | 6.0 |