SGLYVAAKFSESTLDALEELQRSLKLPNPVPRDKLHTTIVYSRVNVPYKVASFEIADKGKLTVFETQSGNRALVLEMDSD
YLSARHSYAKALGASYDYPDYRPHITLSYNIGVLNFSGEYKVPVVLDREYSEELDLEWSD
The query sequence (length=140) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7t27:A | 140 | 140 | 1.0000 | 1.0000 | 1.0000 | 9.24e-101 | |
2 | 7v01:H | 297 | 101 | 0.1857 | 0.0875 | 0.2574 | 0.42 | 8do6:B, 7uzw:H, 7uzx:H, 7uzy:H, 7uzz:H, 7v00:H, 7v02:H |
3 | 4fos:A | 263 | 55 | 0.1286 | 0.0684 | 0.3273 | 0.44 | 4fq8:A, 4fq8:B, 4fr5:A, 4fr5:B, 4fsh:A, 3phh:A, 3phi:A, 3phi:B, 3phj:A, 3phj:B |
4 | 2rau:A | 350 | 52 | 0.1143 | 0.0457 | 0.3077 | 0.82 | |
5 | 1wff:A | 85 | 40 | 0.1071 | 0.1765 | 0.3750 | 1.7 | |
6 | 7jgs:C | 614 | 76 | 0.1500 | 0.0342 | 0.2763 | 4.2 | 7jgr:C, 7jk2:C, 7jk3:C, 7jk4:C, 7jk5:C, 7jk6:C |
7 | 4xgc:C | 567 | 76 | 0.1500 | 0.0370 | 0.2763 | 5.0 |