BioLiP

>protein
SGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQEDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGM
LTFSGPKIPSGVDAGHSERAIPVSR

The query sequence (length=105) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3l1e:A	105	105	1.0000	1.0000	1.0000	4.95e-74
2	4m5s:A	87	82	0.4667	0.5632	0.5976	2.03e-34	4m5t:A, 4m5t:C, 4m5t:E, 4m5t:G
3	6gjh:F	87	85	0.4381	0.5287	0.5412	1.88e-29	6gjh:D, 6gjh:H, 6gjh:B, 4mjh:A, 4mjh:C
4	5lum:A	78	73	0.3714	0.5000	0.5342	4.43e-27	5lum:B, 5lum:D, 5lum:C, 5lum:E
5	6f2r:Q	89	73	0.2952	0.3483	0.4247	1.95e-16	6f2r:T, 6f2r:V
6	3gla:B	99	94	0.2095	0.2222	0.2340	3.99e-04	3gla:A
7	3m85:I	259	68	0.1714	0.0695	0.2647	0.28	3m7n:I, 3m7n:G, 3m7n:H, 3m85:G, 3m85:H
8	8ssz:B	384	44	0.1333	0.0365	0.3182	2.0	6cnj:B, 6cnj:C, 6cnj:E, 6cnk:C, 6cnk:E, 5kxi:B, 5kxi:E, 8st0:B, 8st2:C, 8st2:E, 8st3:B, 8st3:E, 8st4:B, 8st4:E, 6ur8:B, 6usf:E
9	5uwc:G	253	31	0.0952	0.0395	0.3226	4.7
10	7zm7:A	711	41	0.1238	0.0183	0.3171	6.2	7zmb:A, 7zmg:A
11	4v8m:By	189	69	0.1619	0.0899	0.2464	6.5	8ova:By, 8ove:By
12	7d4r:B	215	34	0.1429	0.0698	0.4412	7.2
13	1z1n:X	516	91	0.2381	0.0484	0.2747	7.5
14	2ej9:A	237	50	0.1143	0.0506	0.2400	7.6
15	7k44:A	356	27	0.1143	0.0337	0.4444	9.1
16	6tba:7A	292	33	0.1238	0.0445	0.3939	9.5	6tba:7C, 6tba:7B, 6teh:C

[Back]