SGGAMHGDSLVQLSDSSFKMVKEVKKGDKVICPLLENQCVEVECVVLSKCEDGTKEFVQLGTDLWITPKHPIRVNGEWKY
PKELGQTVVKTSDYIYQFVLKTGHTMNIGGYECICLGHNFQERVAYHPYLGSQAVVEDLKQMKGWKEGKVIIRSRVRDQI
TNQVKAFIQ
The query sequence (length=169) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8r2c:A | 169 | 169 | 1.0000 | 1.0000 | 1.0000 | 6.50e-126 | |
2 | 3wr9:A | 416 | 132 | 0.1716 | 0.0697 | 0.2197 | 0.47 | 3wku:A, 3wku:B, 3wpm:A, 3wpm:B, 3wr3:A, 3wr3:B, 3wr4:A, 3wr4:B, 3wr8:A, 3wr8:B, 3wr9:B, 3wra:A, 3wra:B, 3wrb:A, 3wrb:B, 3wrc:A, 3wrc:B |
3 | 5trd:A | 219 | 54 | 0.1065 | 0.0822 | 0.3333 | 1.3 | 5trd:B |
4 | 3wrg:A | 658 | 47 | 0.0888 | 0.0228 | 0.3191 | 3.5 | 7bzl:A, 7dif:A, 7exu:A, 7exv:A, 7exw:A, 8qf2:A, 3wkx:A, 3wre:A |
5 | 1pv9:B | 318 | 78 | 0.1302 | 0.0692 | 0.2821 | 4.1 | |
6 | 2imz:A | 144 | 43 | 0.0828 | 0.0972 | 0.3256 | 6.7 | 5i0a:A, 3ifj:A, 3ifj:B, 3igd:A, 2imz:B, 5k08:A |
7 | 1jl3:A | 137 | 33 | 0.0710 | 0.0876 | 0.3636 | 8.8 | 1jl3:B, 1jl3:C, 1jl3:D |