BioLiP

>protein
SGFKFLFFSPDGTLYGVHNDKLYKGTPPTSDKDNWLARATLIGNGGW

The query sequence (length=47) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8r3b:A	47	47	1.0000	1.0000	1.0000	1.17e-29	8r3c:A, 8r3c:B, 8r3c:E
2	3kih:B	95	47	0.7447	0.3684	0.7447	1.61e-19	3kih:A, 3kih:C, 3kih:D
3	3kih:B	95	44	0.6383	0.3158	0.6818	3.88e-16	3kih:A, 3kih:C, 3kih:D
4	3kif:I	94	45	0.6809	0.3404	0.7111	4.95e-19	3kif:A, 3kif:B, 3kif:C, 3kif:D, 3kif:E, 3kif:F, 3kif:G, 3kif:J
5	3kif:I	94	30	0.3830	0.1915	0.6000	5.33e-07	3kif:A, 3kif:B, 3kif:C, 3kif:D, 3kif:E, 3kif:F, 3kif:G, 3kif:J
6	3kif:I	94	17	0.2553	0.1277	0.7059	0.007	3kif:A, 3kif:B, 3kif:C, 3kif:D, 3kif:E, 3kif:F, 3kif:G, 3kif:J
7	3b59:A	301	19	0.2340	0.0365	0.5789	0.22	3b59:B, 3b59:C, 3b59:D, 3b59:E, 3b59:F
8	6y2n:A	306	19	0.1915	0.0294	0.4737	2.4
9	6w5c:A	1023	29	0.2128	0.0098	0.3448	4.2
10	6w64:A	928	29	0.2128	0.0108	0.3448	4.2
11	6uae:C	125	25	0.1702	0.0640	0.3200	6.8	6uae:A, 6uae:B, 6uae:D
12	8dba:J	510	26	0.2128	0.0196	0.3846	7.5	8dba:C, 8dba:B, 8dba:F, 8dba:I, 8dba:L
13	8fwj:A	552	26	0.2128	0.0181	0.3846	7.5	8db3:A, 8db3:B, 8db3:C, 8dba:A, 8dba:E, 8dba:D, 8dba:G, 8dba:H, 8dba:K, 8fwi:A, 8fwi:D, 8fwi:B, 8fwi:K, 8fwi:C, 8fwi:F, 8fwi:E, 8fwi:H, 8fwi:G, 8fwi:J, 8fwi:I, 8fwi:L, 8fwj:B, 8fwj:C, 8fwj:D, 8fwj:E, 8fwj:F, 8fwj:G, 8fwj:H, 8fwj:I, 8fwj:J, 8fwj:K, 8fwj:L
14	8w4g:A	876	41	0.3191	0.0171	0.3659	8.2	8w4i:A, 8w4n:A, 8x8g:A
15	4lgj:A	256	16	0.1489	0.0273	0.4375	8.8
16	6jr7:A	812	26	0.2128	0.0123	0.3846	9.9	6jr7:B, 6jr7:C, 6jr7:D, 6jr8:A, 6jr8:B, 6jr8:C, 6jr8:D
17	8ffz:B	905	27	0.1915	0.0099	0.3333	10.0

[Back]