SFTFASPTQVFFNQVDVPTLRPGLVVVFVSSGSQLLAEEAVTLDMLDLGAAKANLEKAQSELLGAADEATRAEIQIRIEA
NEALVKAL
The query sequence (length=88) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2jdi:H | 88 | 88 | 1.0000 | 1.0000 | 1.0000 | 4.43e-58 | 2ck3:H, 2w6j:H |
2 | 4asu:H | 83 | 83 | 0.4773 | 0.5060 | 0.5060 | 3.14e-11 | |
3 | 8ap6:H1 | 161 | 50 | 0.2159 | 0.1180 | 0.3800 | 0.019 | 8ap6:H2, 8ap9:H, 8apa:H1, 8apb:H1, 8apc:H1, 8apd:H1, 8ape:H1, 8aph:H1, 8apj:H1, 8apk:H1 |
4 | 6mhc:A | 244 | 25 | 0.1364 | 0.0492 | 0.4800 | 3.0 | 1eem:A, 4is0:A, 3lfl:A, 3lfl:B, 3lfl:C, 6mhb:A, 6mhb:B, 6mhb:C, 6mhb:D, 6mhb:E, 6mhb:F, 6mhc:B, 6mhd:A, 6mhd:B, 6pnm:A, 6pnn:A, 6pno:A, 5ueh:A, 5v3q:A, 3vln:A, 4yqm:A, 4yqm:B, 4yqm:C, 4yqu:A, 4yqu:B, 4yqv:A, 4yqv:B, 4yqv:C, 5yvn:A, 5yvo:A |
5 | 5nue:B | 332 | 42 | 0.1705 | 0.0452 | 0.3571 | 3.6 | 5nue:A, 5nue:C, 5nuf:A, 5nuf:B, 5nuf:C |
6 | 2oid:A | 266 | 46 | 0.1818 | 0.0602 | 0.3478 | 4.4 | 6f3i:A, 2oid:C, 5uis:D, 5w84:B |
7 | 4bed:B | 1734 | 55 | 0.1932 | 0.0098 | 0.3091 | 6.7 | 4bed:D, 3qjo:A, 3qjo:B |