SFPKYKPSSLRTLPETLDPAEYNISPETRRAQAERLAIRAQLKREYLLQYNDPNRRGLIENPALLRWAYARTINVYPNFR
PTPKNSLMGALCGFGPLIFIYYIIKTERDRKEKLIQEGKLDRTFHLSY
The query sequence (length=128) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5xtc:o | 128 | 128 | 1.0000 | 1.0000 | 1.0000 | 5.70e-92 | 5xtd:o, 5xth:o, 5xti:o, 5xti:Bo |
2 | 5gup:o | 128 | 128 | 0.7812 | 0.7812 | 0.7812 | 6.26e-73 | |
3 | 7luh:A | 191 | 111 | 0.2422 | 0.1623 | 0.2793 | 1.5 | 7luj:A, 7luj:B, 7luj:C, 7luj:D, 5vyo:A, 5vyo:B, 5vyo:C, 5vyo:D |
4 | 5wwp:A | 515 | 98 | 0.2031 | 0.0505 | 0.2653 | 3.5 | |
5 | 5wwp:B | 591 | 98 | 0.2031 | 0.0440 | 0.2653 | 3.9 | |
6 | 1tqy:A | 421 | 35 | 0.1172 | 0.0356 | 0.4286 | 6.3 | 1tqy:C, 1tqy:E, 1tqy:G |
7 | 7pul:A | 347 | 45 | 0.1406 | 0.0519 | 0.4000 | 7.1 |