BioLiP

>protein
SFPEVVELNVGGQVYFTRHSTLISIPHSLLWKMFSLAKDSKGRFFIDRDGFLFRYILDYLRDRQVVLPDHFPEKGRLKRE
AEYFQLPDLVKLLT

The query sequence (length=94) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6ocp:B	99	96	0.9894	0.9394	0.9688	3.70e-62	6m8r:A, 6m8r:F, 6ocp:C, 6ocp:D, 6ocp:E, 6ocp:F, 6ocp:G, 6ocp:H, 6ocp:K, 6ocp:L, 6ocp:M, 6ocp:N
2	6sga:FS	277	66	0.2660	0.0903	0.3788	9.22e-05	6sga:FQ, 6sga:FR, 6sga:FU, 6sgb:FQ, 6sgb:FR, 6sgb:FU
3	2i2r:L	138	68	0.2553	0.1739	0.3529	4.54e-04	2i2r:A, 2i2r:C, 2i2r:D, 2i2r:I, 2i2r:J, 2i2r:K, 2nz0:B, 2nz0:D, 1s1g:A, 1s1g:B
4	2i2r:B	124	68	0.2553	0.1935	0.3529	5.17e-04
5	7e8e:D	459	69	0.2340	0.0479	0.3188	0.006	7e87:B, 7e87:A, 7e87:C, 7e87:D, 7e8e:B, 1nn7:A, 7ukg:A, 7ukg:B, 7ukg:C, 7ukg:D
6	7ukh:A	203	71	0.2447	0.1133	0.3239	0.018	7ukh:B, 7ukh:C, 7ukh:D
7	8quc:A	395	72	0.2447	0.0582	0.3194	0.17	8f1c:A, 8f1c:B, 8f1c:C, 8f1c:D, 8f1d:A, 8f1d:B, 8f1d:C, 8f1d:D, 7phi:C, 7phi:B, 7phi:D, 8quc:B, 8quc:D, 8quc:C, 8qud:A, 8qud:B, 8qud:C, 8qud:D
8	1t3q:B	786	35	0.1489	0.0178	0.4000	0.43	1t3q:E
9	3d7t:A	249	60	0.1383	0.0522	0.2167	0.65	1byg:A
10	8osg:F	258	88	0.2766	0.1008	0.2955	2.6
11	4ttb:A	189	18	0.0851	0.0423	0.4444	7.4	4ttb:B
12	5juy:B	1234	35	0.1702	0.0130	0.4571	8.6	1cy5:A, 3j2t:A, 3j2t:B, 3j2t:C, 3j2t:D, 3j2t:E, 3j2t:F, 3j2t:G, 3jbt:A, 3jbt:C, 3jbt:E, 3jbt:G, 3jbt:I, 3jbt:K, 3jbt:M, 5juy:A, 5juy:C, 5juy:D, 5juy:E, 5juy:F, 5juy:G, 2p1h:A, 5wve:A, 5wve:C, 5wve:E, 5wve:G, 5wve:I, 5wve:K, 5wve:M, 1z6t:A, 1z6t:B, 1z6t:C, 1z6t:D
13	4ttc:A	220	18	0.0851	0.0364	0.4444	9.2	4ttc:B, 4ttc:C, 4ttc:D, 4ttc:E, 4ttc:F, 5yak:A, 5yak:F, 5yak:B, 5yak:C, 5yak:D, 5yak:E

[Back]