BioLiP

>protein
SFEEDPEISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKG

The query sequence (length=46) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2c6a:A	46	46	1.0000	1.0000	1.0000	1.33e-29	2c6b:A, 4xxb:B
2	2cr8:A	53	32	0.3261	0.2830	0.4688	1.09e-06
3	3irb:A	137	31	0.2174	0.0730	0.3226	0.16	3irb:B
4	2ayj:A	56	35	0.2609	0.2143	0.3429	0.25
5	5m60:A	755	36	0.2826	0.0172	0.3611	0.40
6	1nj3:A	31	25	0.2174	0.3226	0.4000	0.65	1q5w:A
7	8hfc:A	276	18	0.1957	0.0326	0.5000	0.86
8	8hf3:A	295	18	0.1739	0.0271	0.4444	2.0
9	7yet:A	999	23	0.1739	0.0080	0.3478	2.1
10	7yes:A	1369	23	0.1739	0.0058	0.3478	2.3	8jsl:A, 8jsm:A, 8jsn:A, 7yer:A
11	5xoo:B	351	43	0.3478	0.0456	0.3721	3.0	5xoo:A
12	7pvn:B	990	30	0.2174	0.0101	0.3333	3.8	7sol:C
13	7sol:A	1011	30	0.2174	0.0099	0.3333	3.9	7pvn:A
14	3a9j:C	32	24	0.1739	0.2500	0.3333	4.6	9avt:C, 9avw:C, 7e62:C, 7e62:J, 2wwz:C, 2wx0:C, 2wx0:G, 2wx1:C
15	7ajt:UM	762	27	0.2609	0.0157	0.4444	4.8	7aju:UM, 7d4i:B3, 7d5s:B3, 7d5t:B3, 7d63:B3, 6ke6:B3, 6lqp:B3, 6lqq:B3, 6lqr:B3, 6lqs:B3, 6lqt:B3, 6lqu:B3, 6lqv:B3, 7suk:LR, 6zqa:UM, 6zqb:UM, 6zqc:UM, 6zqd:UM, 6zqf:UM
16	2k1p:A	33	25	0.2174	0.3030	0.4000	5.7
17	5wyj:BC	783	27	0.2609	0.0153	0.4444	6.4	5wyk:BC
18	2vr0:F	146	29	0.2609	0.0822	0.4138	6.6	2j7a:C, 2j7a:F, 2j7a:I, 2j7a:L, 2j7a:O, 2j7a:R, 2vr0:C

[Back]