SFDRPFEAARPDGENPSAHETLAEGGRLRPEATYTIPARQGRAIRMAQGEALMVINRDGSQIGDFWAFVEGDCGEYLSME
HLRPTLRRVSPRPGDVLVSNRRRPILTLLEDSSPGVHDTLVASCDVHRYAQLGHEGYHDNCTDNLRMALGALGLRPTTVP
CPLNLWMNTPVVEGGAMEWRPPVSRRGDHVLFRAELDVVVVISCCPMDLLPINGEEAQPRALDVRLRPRPA
The query sequence (length=231) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3oru:A | 231 | 230 | 0.9957 | 0.9957 | 1.0000 | 1.69e-170 | 3siy:A, 3siy:B, 3siy:C, 3siy:D |
2 | 3di4:A | 281 | 195 | 0.2294 | 0.1886 | 0.2718 | 1.19e-08 | 3di4:B |
3 | 7f05:C | 355 | 105 | 0.1169 | 0.0761 | 0.2571 | 0.91 | 7f05:B, 7f05:A, 7f05:D |
4 | 8jze:a | 670 | 34 | 0.0606 | 0.0209 | 0.4118 | 1.9 | 8jzf:a |
5 | 6z96:A | 155 | 30 | 0.0606 | 0.0903 | 0.4667 | 2.0 | 6z92:A, 6z92:B, 6z93:A, 6z93:B, 6z94:A, 6z94:B, 6z96:B, 6zw9:A, 6zw9:B |