SEVLPAGLATTVLVPASSANLGPGFDSLGIALSLYDEIEVNTTESGLKVAVEGQGAGEVPLDGSHLVVRAIERGLAAGGA
AAPGLIVQCHNKIPHSRGLGSSAAAAVAGLGVANGLLAKAGRAVLSDDVLVQLASEFEGHPDNAAASVLGGAVVSWSETT
PIYAATRLDVHPDIKIVAAIPETRVLLPQAVTHVDARFNISRVALLTVALTARPDLLMTATEDRLHQPQRASAMPASADV
LAYLRSQGVAAVLSGAGPAVLALTTVDLPDSAVKYAEDQGFSLVAMAVSAGVSVR
The query sequence (length=295) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6cyz:A | 295 | 295 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 6cyz:B |
2 | 1fwk:A | 296 | 305 | 0.2475 | 0.2466 | 0.2393 | 8.96e-10 | 1fwk:B, 1fwk:C, 1fwk:D, 1h72:C, 1h73:A, 1h74:A, 1h74:B, 1h74:C, 1h74:D |
3 | 5m1m:A | 154 | 60 | 0.0542 | 0.1039 | 0.2667 | 0.21 | |
4 | 4dxl:A | 304 | 79 | 0.0983 | 0.0954 | 0.3671 | 0.54 | 4ed4:A, 4emd:A |
5 | 3pye:A | 301 | 86 | 0.0915 | 0.0897 | 0.3140 | 0.96 | 3pyf:A, 3pyg:A |
6 | 6wtf:A | 542 | 62 | 0.0576 | 0.0314 | 0.2742 | 1.9 | 6wtf:B |
7 | 6wte:A | 567 | 62 | 0.0576 | 0.0300 | 0.2742 | 2.1 | 6wte:B |
8 | 4hac:A | 312 | 76 | 0.0814 | 0.0769 | 0.3158 | 2.2 | 4hac:B, 6mde:A, 6mdf:A, 6mdf:B |
9 | 6jw7:A | 342 | 74 | 0.0881 | 0.0760 | 0.3514 | 2.8 | 6jw6:A, 6jw6:B, 6jw7:B, 6jw8:A, 6jw8:B |
10 | 2c26:A | 250 | 37 | 0.0542 | 0.0640 | 0.4324 | 5.8 | 2c4x:A |
11 | 6s21:A | 486 | 65 | 0.0475 | 0.0288 | 0.2154 | 6.6 | 6s21:B, 6s21:C |
12 | 8fni:9 | 858 | 44 | 0.0508 | 0.0175 | 0.3409 | 8.7 | 8fnk:9 |
13 | 9j8e:B | 296 | 104 | 0.0949 | 0.0946 | 0.2692 | 10.0 | 9j8e:A |