BioLiP

>protein
SETVVTEVLGHRVTLPCLYSSWSHNSNSMCWGKDQCPYSGCKEALIRTDGMRVTSRKSAKYRLQGTIPRGDVSLTILNPS
ESDSGVYCCRIEVPGWFNDVKINVRLNLQRALV

The query sequence (length=113) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5f7h:B	113	113	1.0000	1.0000	1.0000	5.27e-82	5f7h:A, 5f7h:C, 5f7h:D, 5f7h:E, 5f7h:F
2	3bib:X	109	108	0.6106	0.6330	0.6389	6.78e-46
3	3kaa:B	109	102	0.4071	0.4220	0.4510	8.64e-27
4	7m3y:B	109	110	0.3982	0.4128	0.4091	2.15e-23	6dhb:A, 7m3z:A, 7m41:A, 7m41:B
5	4jkw:A	119	109	0.2478	0.2353	0.2569	3.99e-05	4k55:A
6	3mj9:A	229	76	0.2035	0.1004	0.3026	0.012
7	6wfy:H	228	96	0.2566	0.1272	0.3021	0.014
8	2zg3:A	210	86	0.2301	0.1238	0.3023	0.12	2zg1:A
9	8jow:A	227	89	0.2212	0.1101	0.2809	0.13	8jow:C
10	2n7b:A	145	97	0.2212	0.1724	0.2577	0.35	7qui:B, 7qui:A
11	6cdp:A	221	93	0.2301	0.1176	0.2796	0.41	6cdm:A, 6cdm:D, 5tkj:A, 5tkj:D, 5tkj:G, 5tkj:J
12	6ldx:H	214	83	0.2212	0.1168	0.3012	0.50	6ldv:H
13	1xed:A	111	89	0.2124	0.2162	0.2697	0.55	1xed:B
14	5j06:B	215	62	0.1416	0.0744	0.2581	0.72	7aw6:A, 7aw6:B, 6d49:A, 6d49:B, 6d4a:A, 6d4a:B, 5j06:D, 5j0b:A, 5j0b:B, 5j0b:C
15	1ao7:D	115	90	0.2301	0.2261	0.2889	1.2	5e9d:D, 5e9d:I
16	4mng:E	228	89	0.2655	0.1316	0.3371	1.5	4mng:F
17	6ldw:H	198	92	0.2212	0.1263	0.2717	1.7	6ldw:B
18	2iep:A	187	16	0.0885	0.0535	0.6250	2.2	2iep:B
19	6xds:A	485	88	0.1593	0.0371	0.2045	2.3	6b8o:B, 6b8o:E, 6b8o:C, 6b8o:F, 6b8o:A, 6b8o:D
20	1bfv:H	119	85	0.2035	0.1933	0.2706	2.3	2bfv:H, 1cfv:H
21	5uhw:A	342	28	0.1239	0.0409	0.5000	2.6	5uhw:B, 5uhz:A, 5uhz:B, 5ui9:A, 5ui9:B, 5uia:A, 5uia:B, 5uib:A, 5uib:B
22	5k6w:A	475	22	0.0885	0.0211	0.4545	2.8	5k6v:A, 5k6w:B
23	5viy:H	223	88	0.2124	0.1076	0.2727	2.9	5viy:J
24	8vig:A	436	68	0.1681	0.0436	0.2794	3.0
25	6rpb:S	189	91	0.2389	0.1429	0.2967	3.1	6rpb:N
26	6iaa:A	815	81	0.2124	0.0294	0.2963	3.8	6iaa:B
27	5v6m:H	213	79	0.2035	0.1080	0.2911	7.2
28	4jfx:L	214	99	0.2389	0.1262	0.2727	7.8	4jfz:L, 4jg0:L, 4jg1:L
29	8qxc:L	214	125	0.3097	0.1636	0.2800	8.1	1axs:L, 1axs:A, 1d6v:L, 8qxc:B, 6xli:B, 6xli:D, 6xli:L, 6xtg:L, 6xuk:L
30	5iqj:A	131	31	0.0885	0.0763	0.3226	9.1	5iqj:C
31	5t8u:B	336	72	0.1858	0.0625	0.2917	9.2	5t8u:A
32	1bih:A	391	50	0.1416	0.0409	0.3200	9.3	1bih:B
33	7ow1:K	214	82	0.2212	0.1168	0.3049	10.0	7oxn:K

[Back]