BioLiP

>protein
SESLTGTLDAPFPEYQTLPADPMSVLHNWLERARRVGIREPRALALATADSQGRPSTRIVVISEISDAGVVFSTHAGSQK
GRELLHNPWASGVLYWRETSQQIILNGQAVRLPNAKADDAWLKRPYATHPMSSVSRQSEELQDVQAMRNAARQLAELQGP
LPRPEGYCVFELRLESLEFWGNGQERLHERLRYDRSDTGWNVRRLQP

The query sequence (length=207) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4hmt:B	207	207	1.0000	1.0000	1.0000	1.07e-153	4hms:A, 4hms:B, 4hmt:A, 4hmu:A, 4hmu:B, 4hmv:A, 4hmv:B, 1ty9:A, 1ty9:B
2	1t9m:A	204	204	0.7198	0.7304	0.7304	1.87e-109	1t9m:B
3	4hmw:B	205	205	0.4831	0.4878	0.4878	3.80e-66	4hmw:A, 4hmx:A, 4hmx:B
4	1jnw:A	214	192	0.2995	0.2897	0.3229	4.96e-34	1dnl:A, 1g76:A, 1g77:A, 1g78:A, 1g79:A, 6ylz:AAA, 6ymh:BBB
5	1nrg:A	213	178	0.2705	0.2629	0.3146	1.67e-25	6h00:A, 3hy8:A, 8qyt:A, 8qyw:A
6	1wv4:A	162	190	0.2512	0.3210	0.2737	7.38e-24	1wv4:B, 6ymh:AAA
7	1ci0:A	205	201	0.2415	0.2439	0.2488	1.13e-13	1ci0:B
8	2i51:A	194	68	0.1063	0.1134	0.3235	0.015	2i51:B
9	9fgp:A	140	60	0.0821	0.1214	0.2833	1.1	9fgp:B
10	6z7n:B	847	80	0.1063	0.0260	0.2750	2.5
11	3lpp:B	869	44	0.0773	0.0184	0.3636	3.8	3lpp:D
12	7q9f:A	1009	61	0.0918	0.0188	0.3115	4.0	7akd:C, 7l56:B, 7l56:C, 7l56:A, 7q9f:B
13	7jr9:D	339	48	0.0725	0.0442	0.3125	5.7
14	5ue8:A	847	18	0.0435	0.0106	0.5000	9.2	5ue8:B, 1y8f:A

[Back]