SERKAINKYYPPDYNPLEAEKLSRKMAKKLKTMNKSHASIRLMTPFSMRCLECNEYIPKSRKFNGKKELLKEKYLDSIKI
YRLTISCPRCANSIAFRTDPGNSDYVMEVGGVRNYLEKRLAKIQQEQEDDEELENLRKKNLEMSQRAEMINRSKHAQQEK
A
The query sequence (length=161) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6j6q:F | 161 | 161 | 1.0000 | 1.0000 | 1.0000 | 4.58e-118 | |
2 | 7b9v:D | 194 | 185 | 0.9627 | 0.7990 | 0.8378 | 3.68e-108 | 5gmk:F, 5lj3:D, 5lj5:D |
3 | 8i0w:Y | 204 | 140 | 0.3851 | 0.3039 | 0.4429 | 9.55e-33 | 5yzg:Y |
4 | 6zym:u | 157 | 134 | 0.3478 | 0.3567 | 0.4179 | 2.35e-32 | |
5 | 8evx:B | 305 | 56 | 0.1056 | 0.0557 | 0.3036 | 0.38 | |
6 | 8evw:B | 326 | 56 | 0.1056 | 0.0521 | 0.3036 | 0.45 | 8evw:A, 8evx:A |
7 | 1mjt:B | 347 | 91 | 0.1553 | 0.0720 | 0.2747 | 5.1 | 1mjt:A |
8 | 7kf3:A | 362 | 30 | 0.0683 | 0.0304 | 0.3667 | 7.1 | 7kf3:B, 7kf3:C, 7kf3:D |
9 | 7vem:A | 347 | 47 | 0.0994 | 0.0461 | 0.3404 | 7.8 | 7vem:B |