SERKAINKYYPPDYNPLEAEKLSRKMAKKLKTMNKSHASIRLMTPFSMRCLECNEYIPKSRKFNGKKELLKEKYLDSIKI
YRLTISCPRCANSIAFRTDPGNSDYVMEVGGVRNY
The query sequence (length=115) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7b9v:D | 194 | 115 | 1.0000 | 0.5928 | 1.0000 | 1.54e-84 | 5gmk:F, 5lj3:D, 5lj5:D |
2 | 6j6q:F | 161 | 115 | 1.0000 | 0.7143 | 1.0000 | 1.35e-83 | |
3 | 6zym:u | 157 | 115 | 0.4522 | 0.3312 | 0.4522 | 5.48e-31 | |
4 | 8i0w:Y | 204 | 115 | 0.4522 | 0.2549 | 0.4522 | 1.20e-30 | 5yzg:Y |
5 | 8evx:B | 305 | 56 | 0.1478 | 0.0557 | 0.3036 | 0.12 | |
6 | 8evw:B | 326 | 56 | 0.1478 | 0.0521 | 0.3036 | 0.13 | 8evw:A, 8evx:A |
7 | 7vem:A | 347 | 47 | 0.1391 | 0.0461 | 0.3404 | 2.3 | 7vem:B |
8 | 7xg9:A | 286 | 52 | 0.1043 | 0.0420 | 0.2308 | 4.3 | 7xg9:B, 7xlf:A, 7xlf:B |
9 | 7sfz:A | 100 | 60 | 0.1304 | 0.1500 | 0.2500 | 8.3 | 7sfz:B, 7sfz:C, 7sfz:D, 7sfz:E, 7sfz:F, 7sfz:G |