SEPQDDDYLYCEMCQNFFIDSCAAHGPPTFVKDSAVDKGHPNRSALSLPPGLRIGPSGIPQAGLGVWNEASDLPLGLHFG
PYEGRITEDEEAANNGYSWLITKGRNCYEYVDGKDKSWANWMRYVNCARDDEEQNLVAFQYHRQIFYRTCRVIRPGCELL
VWYGDEYGQELGIKWGSKWKKELMA
The query sequence (length=185) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4ijd:A | 215 | 184 | 0.9946 | 0.8558 | 1.0000 | 9.78e-140 | 4ijd:B, 6nm4:A, 6nm4:B |
2 | 4c1q:A | 173 | 170 | 0.8270 | 0.8844 | 0.9000 | 8.80e-117 | 4c1q:B |
3 | 3ray:A | 159 | 165 | 0.3892 | 0.4528 | 0.4364 | 6.03e-47 | |
4 | 2l9z:A | 39 | 28 | 0.0541 | 0.2564 | 0.3571 | 0.066 | |
5 | 6xlp:A | 586 | 59 | 0.0973 | 0.0307 | 0.3051 | 0.57 | |
6 | 1e3e:A | 376 | 50 | 0.0865 | 0.0426 | 0.3200 | 1.9 | 1e3e:B, 1e3i:A, 1e3i:B, 1e3l:A, 1e3l:B |
7 | 6pz0:A | 185 | 63 | 0.1027 | 0.1027 | 0.3016 | 4.5 | 6pz0:B, 6q1b:A, 6q1b:B, 6q1l:A, 6q1l:B, 6tyk:A, 6tyk:B |
8 | 3lpp:B | 869 | 54 | 0.0919 | 0.0196 | 0.3148 | 5.7 | 3lpp:D |
9 | 7prj:A | 55 | 18 | 0.0486 | 0.1636 | 0.5000 | 6.3 | |
10 | 8pjn:b | 296 | 73 | 0.1081 | 0.0676 | 0.2740 | 7.2 |