SELLDSFETEFAKFYTDSNLEETNLQKCLDHTHEFKSQLKKLKAHLNKHIQESKKFKRKRELIIEKLSKSQRQWDHSVKK
QIKYVSQQSNRFNKSTLNKLKEFDIDSVYVNKLPKETMENVNEAIGYHILRYSIDNMPLGNKNEAFQYLKDVYGITNKES
TEFIEMGQIVHDLKKGDTESCLKWCSNEMESLSSNHTALSSLKFDLYTLSAMSKVNKELKECTSLFIKEYCAAKHIFFDS
PLFLIVLSGLISFQFFIKYKTIRELAHVDWTTKDELPFDVKLPDFLTHFHPIFICPVLKEETTTENPPYSLACHHIISKK
ALDRLSKNGTITFKCPYCPVNTSMSSTKKVRFVML
The query sequence (length=355) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8pmq:2 | 355 | 355 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 7ns4:b |
2 | 8pjn:b | 296 | 144 | 0.1437 | 0.1723 | 0.3542 | 1.49e-23 | |
3 | 2ct2:A | 88 | 57 | 0.0479 | 0.1932 | 0.2982 | 0.010 | 5fey:A, 5fey:B |
4 | 2l0b:A | 91 | 45 | 0.0423 | 0.1648 | 0.3333 | 6.0 | |
5 | 2ysl:A | 73 | 64 | 0.0366 | 0.1781 | 0.2031 | 9.7 | 2ysj:A |