SELIEQVIEQPDSLIISPPSYNHIQPFVYLHNVLLILNQKITIDLISLWKKCEIIVCADGGANSLYEYFNLQRSDYIPDY
IVGDFDSISPDVKTYYESHGSKIIRQSSQYYNDFTKSIHCIQLHYQLNHTKENWFESIDEVDGLAKLWNGLNNSSDVVVD
IDITIYVLNAIGGRFDQTVQSINQLYIMNEDYPKVTVFFITTNDIIFLLKKGVNYISYKNRLMFHKDNGSSPTPTCGLLP
LSNKTPIILNSYGLKYDMRNWKTEMLGQVSSSNRISGETGFIVECSDDIVMNIEIDV
The query sequence (length=297) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2g9z:A | 297 | 297 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 2g9z:B, 2hh9:A, 2hh9:B |
2 | 1ig0:B | 319 | 317 | 0.3906 | 0.3636 | 0.3659 | 2.56e-53 | 1ig0:A |
3 | 2f17:A | 255 | 279 | 0.2828 | 0.3294 | 0.3011 | 3.46e-32 | 2f17:B, 1ig3:A, 1ig3:B |
4 | 3s4y:A | 224 | 266 | 0.2660 | 0.3527 | 0.2970 | 2.60e-28 | 3s4y:B |
5 | 5m0p:A | 424 | 167 | 0.1246 | 0.0873 | 0.2216 | 0.42 | 4l40:A, 4l54:A, 5m0n:A, 5m0o:A, 5m0o:C, 5m0p:B |
6 | 1r44:A | 202 | 54 | 0.0572 | 0.0842 | 0.3148 | 4.9 | 1r44:B, 1r44:C, 1r44:D, 1r44:E, 1r44:F |
7 | 7r1k:A | 181 | 32 | 0.0438 | 0.0718 | 0.4062 | 6.9 | |
8 | 6gua:A | 821 | 145 | 0.0943 | 0.0341 | 0.1931 | 7.4 | 6gua:B, 6gua:C, 6gua:D, 6gua:E, 6gua:F, 6gua:G, 6gua:H |
9 | 7cnp:A | 559 | 47 | 0.0539 | 0.0286 | 0.3404 | 7.6 | 7cnp:B, 7cnp:C, 7cnq:A, 7cnq:B, 7cnq:C, 7cnq:D, 7d2r:A |