SEKSLEQCKFGTHCTNKRCKYRHARSHIMCREGANCTRIDCLFGHPINEDCRFGVNCKNIYCLFRHPPGRVL
The query sequence (length=72) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2lhn:A | 80 | 72 | 1.0000 | 0.9000 | 1.0000 | 1.06e-49 | 5l2l:A, 5l2l:B, 5l2l:F, 5l2l:E |
2 | 4lj0:A | 65 | 65 | 0.3056 | 0.3385 | 0.3385 | 0.001 | 4lj0:B |
3 | 3zj2:A | 71 | 28 | 0.1667 | 0.1690 | 0.4286 | 0.23 | |
4 | 3zj2:A | 71 | 17 | 0.1250 | 0.1268 | 0.5294 | 6.0 | |
5 | 6bme:A | 127 | 49 | 0.2083 | 0.1181 | 0.3061 | 3.1 | 6bme:B |
6 | 3iar:A | 360 | 28 | 0.1667 | 0.0333 | 0.4286 | 3.4 | 2bgn:E, 2bgn:F, 2bgn:G, 2bgn:H, 2e1w:A, 1krm:A, 1ndv:A, 1ndw:A, 1ndy:A, 1ndz:A, 1o5r:A, 1qxl:A, 7rtg:A, 7rtg:B, 1uml:A, 1v79:A, 1v7a:A, 1vfl:A, 1w1i:E, 1w1i:F, 1w1i:G, 1w1i:H, 1wxy:A, 1wxz:A, 2z7g:A |
7 | 5xrs:G | 321 | 19 | 0.1389 | 0.0312 | 0.5263 | 4.9 | 5xrs:A, 5xrs:C |
8 | 4uny:C | 330 | 22 | 0.1250 | 0.0273 | 0.4091 | 6.7 | 4unx:A, 4unx:C, 4unx:E, 4uny:A, 4uny:E, 4unz:A, 4unz:C, 4unz:E, 4uo1:A, 4uo1:C, 4uo1:E, 4uo2:A, 4uo2:C, 4uo2:E, 4uo5:A, 4uo5:C, 4uo5:E, 4uo6:A, 4uo7:A, 4uo7:C, 4uo7:E, 4uo8:A |
9 | 6wzt:A | 494 | 15 | 0.1250 | 0.0182 | 0.6000 | 8.0 | 6aos:A, 6aot:A, 6aou:A, 6aov:A, 6bkr:A, 6bks:A, 6bkt:A, 6cex:D, 6cex:B, 3eym:B, 3eym:D, 3eym:F, 8faw:A, 1hgg:B, 1hgg:D, 1hgg:F, 1hgh:B, 1hgh:D, 1hgh:F, 1htm:B, 1htm:D, 1htm:F, 6nsa:A, 6nsb:A, 6nsf:A, 6nsg:A, 5t6n:B, 5t6n:D, 5t6n:F, 8tj6:B, 8tj9:A, 8tja:A, 8tjb:A, 4uny:D, 4uo0:D, 8uwa:B, 4wea:A, 2yp3:A, 2yp4:A, 2yp5:A, 2yp8:A, 2yp9:A |
10 | 8tj4:A | 317 | 15 | 0.1250 | 0.0284 | 0.6000 | 8.6 | 8tj4:C, 8tj4:E, 8tj4:G, 8tj6:A, 8tj6:C, 8tj6:E, 8tj6:G, 8tj7:A |
11 | 8tj8:A | 317 | 15 | 0.1250 | 0.0284 | 0.6000 | 9.7 |