SEINTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSLHLVKAKRQGQSMIYSLDDI
HVATMLKQAIHHANHPK
The query sequence (length=97) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 6cdb:A | 97 | 97 | 1.0000 | 1.0000 | 1.0000 | 7.24e-67 | 6cda:A, 6cdb:B, 4ggg:A, 4ggg:B, 2m30:A, 2m30:B, 1r1v:A |
| 2 | 1r23:A | 104 | 90 | 0.3402 | 0.3173 | 0.3667 | 1.29e-11 | 1r22:A, 1r22:B, 1r23:B |
| 3 | 6o8m:A | 95 | 74 | 0.2680 | 0.2737 | 0.3514 | 1.51e-08 | |
| 4 | 2jsc:B | 97 | 81 | 0.2680 | 0.2680 | 0.3210 | 1.63e-08 | 2jsc:A |
| 5 | 1u2w:B | 107 | 93 | 0.2887 | 0.2617 | 0.3011 | 6.68e-08 | 1u2w:A, 1u2w:C |
| 6 | 4omy:A | 97 | 68 | 0.2165 | 0.2165 | 0.3088 | 3.04e-05 | 4omy:B, 4omy:C, 4omy:D, 4on0:A, 4on0:B, 4on0:C, 4on0:D |
| 7 | 5lqw:F | 218 | 83 | 0.2062 | 0.0917 | 0.2410 | 1.3 | |
| 8 | 6vu9:A | 631 | 57 | 0.1753 | 0.0269 | 0.2982 | 1.5 | |
| 9 | 7dco:R | 261 | 67 | 0.1856 | 0.0690 | 0.2687 | 1.7 | 7b9v:M, 6bk8:G, 6exn:M, 5gm6:R, 5gmk:R, 6j6g:R, 6j6h:R, 6j6n:R, 6j6q:R, 5lj3:M, 5lj5:M, 5mps:M, 5mq0:M, 3tp2:A, 3tp2:B, 3u1l:A, 3u1m:A, 5wsg:R, 5y88:N, 5ylz:N |
| 10 | 4kdp:A | 151 | 43 | 0.1237 | 0.0795 | 0.2791 | 3.1 | 4ejv:A, 4ejv:B, 4ejw:A, 4ejw:B, 4kdp:B, 4kdp:C, 4kdp:D, 3kp2:A, 3kp2:B, 3kp3:B, 3kp4:A, 3kp4:B, 3kp5:A, 3kp5:B |
| 11 | 8y6u:H | 92 | 81 | 0.2371 | 0.2500 | 0.2840 | 5.3 | 8y6u:J |
| 12 | 7sr6:A | 566 | 24 | 0.1237 | 0.0212 | 0.5000 | 6.9 | 7sr6:F, 7sr6:G |
umich.edu