SEFLTVRLSSEQYSPIPWLVWSSSQQEVIASGELSDWQQLDDLKNYAEQRPIVVLVAASDVVLTEVDIPPGASRQFESML
PYLLEDEIAQDVDDLHFSVLAKENGKAQVCGVDRRWLQHMLDAFRAQGLDVKRVLPDSLALPLDDEGISAAQLGEQWLFR
HSACQGSAVDDSWMPVYLNSVACFSSLPEQQAHWLSRPVEMTMALLSQGVADGKFSLLTGEFKP
The query sequence (length=224) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4pht:Y | 226 | 226 | 1.0000 | 0.9912 | 0.9912 | 1.38e-162 | 4pht:X, 4pht:Z |
2 | 3c4a:A | 365 | 68 | 0.0938 | 0.0575 | 0.3088 | 1.8 | |
3 | 8xho:A | 262 | 47 | 0.0714 | 0.0611 | 0.3404 | 3.9 | 8xho:B |
4 | 3was:A | 389 | 41 | 0.0536 | 0.0308 | 0.2927 | 4.1 | 4kmi:A, 4kmi:B, 3was:B, 3wat:A, 3wat:B, 3wau:A, 3wau:B |
5 | 2j8m:A | 171 | 99 | 0.1205 | 0.1579 | 0.2727 | 5.4 | 2bl1:A, 2j8m:B, 2j8r:A, 2j8r:B |
6 | 4fdt:A | 398 | 87 | 0.1116 | 0.0628 | 0.2874 | 6.2 | 4fdt:B, 4fdu:A, 4fdu:B |
7 | 4emy:A | 409 | 76 | 0.0893 | 0.0489 | 0.2632 | 7.3 | 4emy:B, 4emy:C, 4emy:D |
8 | 4q94:A | 129 | 47 | 0.0625 | 0.1085 | 0.2979 | 7.7 | 9b9l:A, 4q94:B, 4q96:A, 4q96:B, 4q96:D, 4q96:E |