SEDVKYFTRAEVAKNNTKDKNWFIIHNNVYDVTAFLNEHPGGEEVLIEQAGKDATEHFEDVGHSSDAREMMKQYKVGELV
AEERSN
The query sequence (length=86) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2ibj:A | 86 | 86 | 1.0000 | 1.0000 | 1.0000 | 1.40e-60 | |
2 | 3ner:B | 91 | 76 | 0.5930 | 0.5604 | 0.6711 | 9.97e-35 | 3ner:A |
3 | 3ozz:B | 82 | 81 | 0.5930 | 0.6220 | 0.6296 | 1.12e-34 | |
4 | 1awp:A | 86 | 76 | 0.5581 | 0.5581 | 0.6316 | 2.56e-34 | 1awp:B, 1b5m:A, 1eue:A, 1eue:B, 4hil:A, 4hil:B, 1icc:C, 3mus:A |
5 | 1aw3:A | 94 | 84 | 0.5930 | 0.5426 | 0.6071 | 1.67e-33 | 1axx:A, 2axx:A, 1b5a:A, 1b5b:A, 1bfx:A, 1blv:A, 1do9:A, 1mny:A |
6 | 2i96:A | 108 | 84 | 0.5930 | 0.4722 | 0.6071 | 2.56e-33 | 4hin:A, 4hin:B, 4hin:C, 4hin:D, 2m33:A |
7 | 1hko:A | 104 | 85 | 0.5930 | 0.4904 | 0.6000 | 2.96e-33 | 1aqa:A, 1cyo:A, 1ehb:A, 1es1:A, 1f03:A, 1f04:A, 1i5u:A, 1ib7:A, 1j0q:A, 1jex:A, 1lqx:A, 1lr6:A, 1m20:A, 1m2i:A, 1m2m:A, 1m59:A, 1nx7:A, 1sh4:A, 1u9m:A, 1u9m:B, 1u9m:C, 1u9m:D, 1u9m:E, 1u9m:F, 1u9u:A, 3x32:A, 3x33:A, 3x34:A, 3x35:A |
8 | 2i89:A | 90 | 76 | 0.5698 | 0.5444 | 0.6447 | 3.90e-33 | 2i89:B, 2i89:C, 2i89:D, 1icc:A, 1icc:B, 1icc:D, 1lj0:A, 1lj0:B, 1lj0:C, 1lj0:D, 3mus:B |
9 | 4b8n:B | 90 | 74 | 0.3837 | 0.3667 | 0.4459 | 1.32e-15 | 4b8n:A, 4b8n:C, 4b8n:D |
10 | 1cxy:A | 81 | 80 | 0.3023 | 0.3210 | 0.3250 | 1.69e-13 | |
11 | 3lf5:A | 87 | 72 | 0.3256 | 0.3218 | 0.3889 | 2.02e-13 | 3lf5:B |
12 | 7bwh:A | 88 | 79 | 0.3023 | 0.2955 | 0.3291 | 3.54e-13 | |
13 | 1x3x:A | 82 | 72 | 0.3488 | 0.3659 | 0.4167 | 2.88e-12 | 1x3x:B |
14 | 1kbi:A | 504 | 50 | 0.3140 | 0.0536 | 0.5400 | 3.25e-11 | 1fcb:A, 1fcb:B, 1kbi:B, 1kbj:A, 1kbj:B, 3ks0:A, 3ks0:B, 1lco:A, 1lco:B, 1ldc:A, 1ltd:A, 1ltd:B, 2oz0:A, 2oz0:B, 1qcw:A, 1qcw:B, 1sze:A, 1sze:B, 1szf:A, 1szf:B, 1szg:A, 1szg:B |
15 | 1mj4:A | 79 | 72 | 0.2907 | 0.3165 | 0.3472 | 1.31e-08 | |
16 | 1sox:A | 463 | 81 | 0.3372 | 0.0626 | 0.3580 | 2.77e-08 | 2a9a:A, 2a9a:B, 2a9b:A, 2a9c:A, 2a9c:B, 2a9d:A, 2a9d:B, 3hbp:A, 3hbq:A, 1sox:B |
17 | 8tgb:A | 108 | 48 | 0.2093 | 0.1667 | 0.3750 | 4.79e-08 | 8tgb:B |
18 | 6nzx:A | 76 | 75 | 0.2326 | 0.2632 | 0.2667 | 0.016 | |
19 | 3ib9:A | 521 | 37 | 0.1744 | 0.0288 | 0.4054 | 0.67 | 3ib9:B, 1xny:A, 1xny:B |
20 | 4wt7:A | 294 | 41 | 0.1628 | 0.0476 | 0.3415 | 4.1 | 4wt7:B |
21 | 4jz6:A | 484 | 61 | 0.2093 | 0.0372 | 0.2951 | 5.4 | |
22 | 4nq8:B | 301 | 40 | 0.1395 | 0.0399 | 0.3000 | 5.6 | 4nq8:A |
23 | 2pyb:A | 151 | 73 | 0.2791 | 0.1589 | 0.3288 | 7.2 | 2pyb:B, 2pyb:C, 2pyb:D |
24 | 8c8v:A | 1032 | 19 | 0.1279 | 0.0107 | 0.5789 | 9.1 | 8c8u:A, 8c8w:A, 8c9d:A |