SEACEMCRLGLPHGSFFELLRDWKKIEEFRNK
The query sequence (length=32) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5we2:B | 32 | 32 | 1.0000 | 1.0000 | 1.0000 | 1.48e-18 | 5we1:D, 5xxe:C, 5xxe:D, 5xxf:C, 5xxf:D |
2 | 8snz:A | 167 | 23 | 0.3125 | 0.0599 | 0.4348 | 1.4 | 8snz:B, 8v2y:A |
3 | 6slm:A | 539 | 19 | 0.2812 | 0.0167 | 0.4737 | 4.2 | |
4 | 4u3e:A | 637 | 21 | 0.2500 | 0.0126 | 0.3810 | 5.2 | 4coi:A, 4coi:B, 4coj:A, 4coj:B, 4col:A, 4col:B, 4com:A, 4com:B, 4u3e:B |
5 | 5fv0:B | 458 | 19 | 0.3125 | 0.0218 | 0.5263 | 8.0 | |
6 | 4lya:A | 521 | 19 | 0.3125 | 0.0192 | 0.5263 | 8.0 | 5fv0:A |
7 | 7cfd:F | 182 | 18 | 0.2812 | 0.0495 | 0.5000 | 8.6 | 7cfd:B, 7cfd:A, 7cfd:C, 7cfd:E, 7cfd:G, 7cfd:H, 7cfd:D |