SDSNTITSFQVDCYLWHIRKLLSMRDMCDAPFDDRLRRDQKALKGRGSTLGLDLRVATMEGKKIVEDILKS
The query sequence (length=71) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6zlc:A | 77 | 71 | 1.0000 | 0.9221 | 1.0000 | 4.41e-48 | 6sx0:A, 6sx0:B, 6sx2:A, 6sx2:B, 6zlc:B |
2 | 2z0a:A | 72 | 70 | 0.6338 | 0.6250 | 0.6429 | 4.19e-30 | 2z0a:C, 2z0a:D, 2zko:A, 2zko:B |
3 | 4q56:A | 101 | 18 | 0.1268 | 0.0891 | 0.5000 | 0.64 | |
4 | 3hq7:A | 304 | 26 | 0.1831 | 0.0428 | 0.5000 | 1.4 | |
5 | 3hq6:A | 324 | 26 | 0.1831 | 0.0401 | 0.5000 | 1.4 | 3hq6:B, 3hq8:A, 3hq8:B, 3hq9:A, 3hq9:B |
6 | 4g9i:A | 766 | 51 | 0.2113 | 0.0196 | 0.2941 | 3.6 | 4g9i:B, 4g9i:C, 4g9i:D, 4g9i:E, 4g9i:F |