Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
SDQTWVQCDACLKWRKLPDGMLPEKWYCSNNPDPQFRNCEVPEEPE

The query sequence (length=46) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 6o5w:A 57 48 0.9783 0.7895 0.9375 1.37e-27
2 6o1e:A 431 47 0.9783 0.1044 0.9574 3.82e-27 5ix1:B, 5ix2:A, 5ix2:B, 4qq4:A, 4qq4:B, 5svi:A, 5svi:B, 5svx:A, 5svy:A
3 5ix1:A 414 47 0.9565 0.1063 0.9362 1.26e-26
4 7k7t:A 390 46 0.6304 0.0744 0.6304 3.27e-13 7k7t:B
5 5ofb:B 541 43 0.4783 0.0407 0.5116 1.47e-10 5of9:A, 5of9:B, 5ofa:B, 5ofa:A, 5ofb:A
6 6qxz:A 79 49 0.3696 0.2152 0.3469 3.61e-08
7 2l7p:A 100 49 0.3696 0.1700 0.3469 4.75e-08 5yvx:A
8 2e61:A 69 47 0.4348 0.2899 0.4255 7.01e-06 2rr4:A
9 4o62:B 57 50 0.4348 0.3509 0.4000 2.62e-05 4o62:A, 4o62:C, 4z0o:A, 4z0r:B, 4z0r:A, 4z0r:C
10 5u2o:A 543 23 0.2174 0.0184 0.4348 0.99
11 8e1u:A 1126 16 0.1739 0.0071 0.5000 1.6 8e1u:B, 8e1u:C, 8e1u:D, 8e1u:E, 8e1u:F, 8e1u:G, 8e1u:H
12 7yet:A 999 17 0.1739 0.0080 0.4706 2.7
13 7yes:A 1369 17 0.1739 0.0058 0.4706 3.0 8jsl:A, 8jsm:A, 8jsn:A, 7yer:A
14 8ip8:HB 205 24 0.1739 0.0390 0.3333 3.2 8ipa:HB, 8ipb:HB, 8jiv:CI
15 5dl8:B 391 24 0.2174 0.0256 0.4167 3.7 5dl8:A
16 4v3p:LI 184 24 0.1739 0.0435 0.3333 4.2 4v7e:CI
17 3jcs:N 213 19 0.1522 0.0329 0.3684 4.2 6az3:N, 8ovj:N, 8rxh:LN, 8rxx:LN, 5t2a:J
18 8fr7:A 1275 11 0.1304 0.0047 0.5455 4.4 8fr7:C, 8fr7:B
19 2e8y:A 712 21 0.2174 0.0140 0.4762 5.0 2e8y:B, 2e8z:A, 2e8z:B, 2e9b:A, 2e9b:B
20 4kto:A 377 16 0.1957 0.0239 0.5625 5.8 4kto:C, 4kto:B, 4kto:D
21 6zu5:LI0 209 20 0.1739 0.0383 0.4000 6.1
22 3t6v:A 495 15 0.1304 0.0121 0.4000 6.4 3t6v:B, 3t6v:C, 3t6w:A, 3t6w:B, 3t6w:C, 3t6x:A, 3t6x:B, 3t6x:C, 3t6z:A, 3t6z:B, 3t6z:C, 3t71:A, 3t71:B, 3t71:C
23 3j79:Q 189 20 0.1739 0.0423 0.4000 8.8 3jbn:AQ, 3jbo:AQ, 3jbp:AQ, 8tpu:AQ, 5umd:Q
24 8azw:g 209 24 0.1522 0.0335 0.2917 9.6 8b2l:g3, 7qiw:L, 7qiz:L
25 7ayx:B 396 38 0.3043 0.0354 0.3684 9.8 7ayx:A

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218