SDQALSFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRY
FPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFTGLGNCI
TKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQ
SGRKGADIMYTGTVDCWRKIAKDEGPKAFFKGAWSNVLRGMGGAFVLVLYDEI
The query sequence (length=293) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2c3e:A | 293 | 293 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 1okc:A |
2 | 4c9q:B | 290 | 292 | 0.5256 | 0.5310 | 0.5274 | 2.27e-99 | 4c9g:A, 4c9h:A, 4c9h:B, 4c9j:A, 4c9j:B, 4c9q:A |
3 | 6gci:A | 292 | 292 | 0.5222 | 0.5240 | 0.5240 | 3.94e-96 | |
4 | 8hbw:A | 290 | 292 | 0.2321 | 0.2345 | 0.2329 | 8.21e-19 | 8g8w:A, 8j1n:A |
5 | 8gym:m2 | 318 | 171 | 0.1672 | 0.1541 | 0.2865 | 7.19e-08 | 8gym:M2 |
6 | 8gym:m2 | 318 | 289 | 0.2253 | 0.2075 | 0.2284 | 2.08e-05 | 8gym:M2 |
7 | 4mif:B | 581 | 49 | 0.0478 | 0.0241 | 0.2857 | 0.98 | 4mif:A, 4mif:C, 4mif:D, 4mig:A, 4mig:B, 4mig:C, 4mig:D, 4mih:A, 4mih:B, 4mih:C, 4mih:D, 4mih:E, 4mih:F, 4mih:G, 4mih:H |
8 | 5nja:D | 444 | 85 | 0.0785 | 0.0518 | 0.2706 | 2.0 | 5nja:B |
9 | 6kbh:A | 765 | 66 | 0.0614 | 0.0235 | 0.2727 | 2.8 |