SDPLVVAASIIGILHLILWILDRLFFKSIYRFFEHGLK
The query sequence (length=38) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2rlf:C | 38 | 38 | 1.0000 | 1.0000 | 1.0000 | 2.67e-21 | |
2 | 2ly0:A | 31 | 27 | 0.6842 | 0.8387 | 0.9630 | 3.94e-12 | 2muw:C |
3 | 3of1:A | 246 | 23 | 0.2632 | 0.0407 | 0.4348 | 0.33 | |
4 | 6c6g:A | 457 | 30 | 0.2895 | 0.0241 | 0.3667 | 1.1 | 6c6g:B |
5 | 3pya:A | 688 | 21 | 0.2632 | 0.0145 | 0.4762 | 1.9 | 4lix:A, 3pyb:A |
6 | 6slf:A | 398 | 17 | 0.2895 | 0.0276 | 0.6471 | 3.3 | 6slf:B, 6slf:C, 6slf:D |
7 | 5c8w:B | 121 | 24 | 0.2632 | 0.0826 | 0.4167 | 3.8 | 5c6c:A, 5c6c:B, 5c8w:A, 5c8w:C, 5c8w:D, 5c8w:E, 5c8w:F |
8 | 6rsx:A | 266 | 23 | 0.2632 | 0.0376 | 0.4348 | 5.9 | |
9 | 1js8:A | 382 | 26 | 0.2632 | 0.0262 | 0.3846 | 6.8 | 1js8:B |
10 | 6ny5:A | 386 | 40 | 0.3947 | 0.0389 | 0.3750 | 7.4 | 6ny5:B |
11 | 1zsw:A | 328 | 11 | 0.1842 | 0.0213 | 0.6364 | 9.4 |