SDIADGQTQRFDFSILQSMAHDLAQTAWRGAPRPLPDTLATMTPQAYNSIQYDAEKSLWHNVENRQLDAQFFHMGMGFRR
RVRMFSVDPATHLAREIHFRPELFKYNDAGVDTKQLEGQSDLGFAGFRVFKAPELARRDVVSFLGASYFRAVDDTYQYGL
SARGLAIDTYTDSKEEFPDFTAFWFDTVKPGATTFTVYALLDSASITGAYKFTIHCEKSQVIMDVENHLYARKDIKQLGI
APMTSMFSCGTNERRMCDTIHPQIHDSDRLSMWRGNGEWICRPLNNPQKLQFNAYTDNNPKGFGLLQLDRDFSHYQDIMG
WYNKRPSLWVEPRNKWGKGTIGLMEIPTTGETLNNIVCFWQPEKAVKAGDEFAFQYRLYWSAQPPVHCPLARVMATRTGM
GGFSEGWAPGEHYPEKWARRFAVDFVGGDLKAAAPKGIEPVITLSSGEAKQIEILYIEPIDGYRIQFDWYPTSDSTDPVD
MRMYLRCQGDAISETWLYQYFPPAPDKRQYVDDRVMSLEHHHHH
The query sequence (length=524) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8iox:A | 524 | 524 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 8iox:C, 8iox:D, 8iox:E, 8iox:F, 8iox:G, 8iox:H, 8iox:I, 8iox:J, 8iox:K, 8ip1:A, 8ip1:B |
2 | 8ip2:A | 478 | 497 | 0.3550 | 0.3891 | 0.3742 | 2.51e-95 | |
3 | 7un8:A | 297 | 50 | 0.0267 | 0.0471 | 0.2800 | 3.2 | 7un8:B, 7un8:C, 7un8:D, 7un8:E, 7un8:F, 7un9:A, 7un9:B, 7un9:C, 7un9:D, 7un9:I, 7un9:J, 7un9:E, 7un9:F, 7un9:K, 7un9:L, 7una:A, 7una:B, 7una:C |
4 | 7al4:D | 524 | 64 | 0.0382 | 0.0382 | 0.3125 | 5.4 | 7al4:C, 7al4:B, 7al4:A |
5 | 3q2w:A | 541 | 28 | 0.0248 | 0.0240 | 0.4643 | 6.2 | 1ncj:A, 4num:A, 4num:B, 4num:C, 4num:D, 4nup:A, 4nup:B, 4nup:C, 4nuq:A, 2qvi:A |