SDGDTAMKAFNDTFWDPNAKMFWKDSKREKHQDFWVEAELWELVMDAYQHTSDPALKAELKTQIDDVYDGTVAKYGQDWT
NNPFNDNIMWWAMGSARAYQITGNPRYLEAARDHFDFVYDTQWDEEFANGGIWWLNSDHNTKNACINFPAAQAALYLYDI
TKDEHYLNAATKIFRWGKTMLTDGNGKVFDRIEIEHGAVPDATHYNQGTYIGSAVGLYKATGNAVYLDDAVKAAKFTKNH
LVDSNGVLNYEGPNGDLKGGKTILMRNLAHLQKTLDETGQYPEFSAEFDEWLAFNIEMAWSHQNSDHIVDGNWATYESWS
SAAAVQALNG
The query sequence (length=330) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5agd:B | 344 | 336 | 1.0000 | 0.9593 | 0.9821 | 0.0 | 5agd:A, 4boj:A, 4boj:B, 4boj:C, 4d4b:A, 4d4b:B, 4d4c:A, 4d4c:B, 4d4d:A, 4d4d:B, 5m77:A, 5m77:B, 5n0f:A, 5n0f:B, 7nl5:A, 6zbm:A, 6zbw:A, 6zbw:B, 6zbx:A, 6zbx:B |
2 | 6shm:A | 339 | 289 | 0.2939 | 0.2861 | 0.3356 | 6.67e-31 | 6y8f:A |
3 | 8wbu:A | 391 | 121 | 0.0939 | 0.0793 | 0.2562 | 0.064 | 7d5g:A, 8wbv:A |
4 | 8wbu:A | 391 | 176 | 0.1152 | 0.0972 | 0.2159 | 0.31 | 7d5g:A, 8wbv:A |
5 | 8wbu:A | 391 | 28 | 0.0394 | 0.0332 | 0.4643 | 4.5 | 7d5g:A, 8wbv:A |
6 | 2d8l:A | 363 | 81 | 0.0758 | 0.0689 | 0.3086 | 0.079 | 2gh4:A |
7 | 2d8l:A | 363 | 48 | 0.0485 | 0.0441 | 0.3333 | 2.9 | 2gh4:A |
8 | 4g68:A | 392 | 63 | 0.0576 | 0.0485 | 0.3016 | 0.21 | 4g68:B |
9 | 8idp:A | 446 | 69 | 0.0697 | 0.0516 | 0.3333 | 0.30 | 8idp:C, 8idp:B, 8idp:D, 8idq:A, 8idq:B, 8idq:C, 8idq:D |
10 | 8idr:C | 147 | 40 | 0.0485 | 0.1088 | 0.4000 | 1.00 | 8idr:A, 8idr:B, 8idr:D, 8idu:A, 8idu:B, 8idu:C, 8idu:D, 8idu:E, 8idu:F |
11 | 8ht4:B | 390 | 92 | 0.0848 | 0.0718 | 0.3043 | 1.7 | 8ht4:A |
12 | 6rxy:Cz | 275 | 92 | 0.0667 | 0.0800 | 0.2391 | 1.9 | 6rxz:Cz |
13 | 7vcf:T | 763 | 81 | 0.0606 | 0.0262 | 0.2469 | 2.8 | |
14 | 5meh:A | 438 | 192 | 0.1424 | 0.1073 | 0.2448 | 2.9 | 4ayp:A, 4ayq:A, 4ayr:A, 8b5m:A, 5ne5:A |
15 | 2q02:A | 272 | 65 | 0.0636 | 0.0772 | 0.3231 | 3.2 | 4hgx:A, 4hgx:B, 2q02:B, 2q02:C, 2q02:D |
16 | 4q5n:A | 220 | 75 | 0.0606 | 0.0909 | 0.2667 | 4.2 | 4q5n:B |
17 | 6ex6:A | 634 | 39 | 0.0545 | 0.0284 | 0.4615 | 6.8 | 6ex6:B |
18 | 4q8g:B | 353 | 106 | 0.0758 | 0.0708 | 0.2358 | 8.3 | 4q8g:A |
19 | 3bgu:A | 106 | 46 | 0.0424 | 0.1321 | 0.3043 | 8.4 |