BioLiP

>protein
SDEIVWQIINQQFCAFKLKTTKGQNFCRNEYSVSGLCNRQSCPLANSRYATVRQSPKGTIYLYIKTIERSHMPSKWWEKI
KLSQNYQKALEQIDQRLQFFPKFLIHKCKQRLTRLVQVAIRMRRIAAEEARLGEKLVPKMAPKIKKREEARERKALAAAK
LERTIERELLDRLRQGAYGDQPLNCNPQIWKKVL

The query sequence (length=194) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8i9p:Ce	194	194	1.0000	1.0000	1.0000	2.58e-144	8i9r:Ce, 8i9t:Ce, 8i9v:Ce
2	6c0f:D	190	194	0.6031	0.6158	0.6031	2.31e-85	6cb1:D, 8e5t:D, 6em1:3, 6em3:3, 6em4:3, 6em5:3, 7ohs:3, 7ohw:3, 7ohx:3, 8v83:R, 8v84:R, 5z3g:Z
3	8eup:3	194	193	0.5979	0.5979	0.6010	1.49e-81	8esq:3, 8etc:3, 8etg:3, 8eth:3, 8eti:3, 8etj:3, 8eug:3, 8eui:3, 8euy:3, 8ev3:3
4	8fkp:NM	182	181	0.5052	0.5385	0.5414	2.13e-61	8fkr:NM, 8fkt:NM, 8fkv:NM
5	8f5o:B	1134	106	0.1495	0.0256	0.2736	0.90	8f5p:B
6	6nd4:U	407	58	0.0928	0.0442	0.3103	5.8
7	7ajt:JP	461	58	0.0928	0.0390	0.3103	6.7	7aju:JP, 7d4i:5I, 7d5s:5I, 7d5t:5I, 7d63:5I, 6ke6:5I, 6lqp:5I, 6lqq:5I, 6lqr:5I, 6lqs:5I, 6lqt:5I, 6lqu:5I, 6lqv:5I, 7suk:LU, 5wlc:LU, 6zqa:JP, 6zqb:JP, 6zqc:JP, 6zqd:JP
8	7d4i:RP	2084	45	0.0670	0.0062	0.2889	7.1	7d5t:RP
9	6lqs:RP	2180	45	0.0670	0.0060	0.2889	7.1	7d63:RP, 6lqp:RP, 6lqq:RP, 6lqr:RP, 6lqt:RP, 6lqu:RP, 6lqv:RP
10	7suk:SP	2234	45	0.0670	0.0058	0.2889	7.3	6zqb:UT
11	7aju:UT	2313	45	0.0670	0.0056	0.2889	7.5	7ajt:UT, 6zqc:UT, 6zqd:UT, 6zqe:UT
12	7l7b:C	1166	49	0.0825	0.0137	0.3265	9.4
13	8b9d:2	576	86	0.0979	0.0330	0.2209	9.6

[Back]