SDDALAFLSERHLAMLTTLRADNSPHVVAVGFTFDPKTHIARVITTGGSQKAVNADRSGLAVLSQVDGARWLSLEGRAAV
NSDIDAVRDAELRYAQRYRTPRPNPRRVVIEVQIERVLGSADLLD
The query sequence (length=125) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 5jab:A | 135 | 125 | 1.0000 | 0.9259 | 1.0000 | 2.92e-88 | 2asf:A, 5jab:B, 5jab:C, 5jab:D |
| 2 | 8aa2:E | 497 | 66 | 0.1680 | 0.0423 | 0.3182 | 0.005 | 8aa2:M, 6r3r:A, 6r3u:A, 7znr:A, 7znr:B, 7zns:A, 7zns:B |
| 3 | 4tm7:A | 243 | 42 | 0.1280 | 0.0658 | 0.3810 | 0.50 | |
| 4 | 8hku:L13P | 140 | 72 | 0.2000 | 0.1786 | 0.3472 | 0.97 | 8hkv:L13P, 8hky:L13P, 8hkz:L13P, 8hl1:L13P, 8hl2:L13P, 8hl3:L13P, 8hl4:L13P, 8hl5:L13P |
| 5 | 5jv4:A | 142 | 30 | 0.1040 | 0.0915 | 0.4333 | 1.5 | 5jv4:D, 5jv4:B, 5jv4:E, 5jv4:C, 5jv4:F |
| 6 | 1e8u:B | 449 | 50 | 0.1200 | 0.0334 | 0.3000 | 4.5 | 7bwu:B, 7bwu:D, 7bwu:A, 7bwu:C, 1e8t:A, 1e8u:A, 1e8v:A, 1e8v:B, 1usr:A, 1usr:B, 1usx:A, 1usx:B, 1usx:C |
| 7 | 6hyp:A | 2272 | 46 | 0.1120 | 0.0062 | 0.3043 | 5.4 | |
| 8 | 1ddv:A | 104 | 32 | 0.0800 | 0.0962 | 0.3125 | 6.2 | |
| 9 | 5jcs:s | 2003 | 46 | 0.1120 | 0.0070 | 0.3043 | 6.2 | |
| 10 | 7wi7:A | 565 | 34 | 0.0960 | 0.0212 | 0.3529 | 7.7 | |
| 11 | 7suk:LV | 362 | 88 | 0.1760 | 0.0608 | 0.2500 | 8.5 | 7ajt:JC, 7d63:RA, 6ke6:RA, 6lqp:RA, 6lqq:RA, 6lqr:RA, 6lqu:RA, 6lqv:RA, 5wlc:LV, 6zqb:JC, 6zqc:JC |
| 12 | 8omd:A | 296 | 47 | 0.0960 | 0.0405 | 0.2553 | 8.8 | 8omd:C, 8omd:B, 8omd:D, 6p2d:A |
umich.edu