BioLiP

>protein
SDAFKTALCDAYKRSQACSYGDQCRFAHGVHELRLPMNPRGRNHPKYKTVLCDKFSMTGNCKYGTRCQFIHKIVDGNA

The query sequence (length=78) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6nzl:A	78	78	1.0000	1.0000	1.0000	4.54e-56
2	1rgo:A	70	71	0.4615	0.5143	0.5070	4.85e-19
3	1rgo:A	70	29	0.1410	0.1571	0.3793	1.0
4	1m9o:A	40	34	0.2308	0.4500	0.5294	1.14e-06
5	1m9o:A	40	31	0.1795	0.3500	0.4516	1.25e-05
6	6pmg:X	35	28	0.2051	0.4571	0.5714	7.66e-04
7	6pmg:X	35	30	0.1410	0.3143	0.3667	2.0
8	7dco:M	176	95	0.3462	0.1534	0.2842	0.004	5gm6:a
9	7dco:M	176	42	0.1538	0.0682	0.2857	0.20	5gm6:a
10	5elk:A	121	63	0.2308	0.1488	0.2857	0.030
11	5elk:A	121	78	0.2692	0.1736	0.2692	3.9
12	6ff4:t	172	43	0.1667	0.0756	0.3023	0.078	8ch6:Z, 6ff7:t, 7qtt:Z
13	6ff4:t	172	25	0.1154	0.0523	0.3600	0.96	8ch6:Z, 6ff7:t, 7qtt:Z
14	7dvq:M	191	43	0.1667	0.0681	0.3023	0.089	8i0r:K, 8i0s:K, 8i0t:K, 5z56:M, 5z58:M
15	7dvq:M	191	25	0.1154	0.0471	0.3600	0.84	8i0r:K, 8i0s:K, 8i0t:K, 5z56:M, 5z58:M
16	2fc6:A	50	31	0.1538	0.2400	0.3871	0.10
17	6dnh:C	117	71	0.2821	0.1880	0.3099	0.12	8e3i:C, 8e3q:C, 6fuw:C, 8r8r:C, 2rhk:D, 6urg:C, 6uro:C
18	6dnh:C	117	32	0.1538	0.1026	0.3750	2.5	8e3i:C, 8e3q:C, 6fuw:C, 8r8r:C, 2rhk:D, 6urg:C, 6uro:C
19	8y6o:V	101	20	0.1282	0.0990	0.5000	0.16
20	7tr1:K	346	28	0.1795	0.0405	0.5000	0.68	7lff:A, 7lff:B
21	7tr3:K	418	28	0.1795	0.0335	0.5000	0.81	7tqx:K, 7tqy:K, 7tr0:K
22	2d9m:A	69	27	0.1538	0.1739	0.4444	0.86
23	2d9m:A	69	21	0.1154	0.1304	0.4286	6.8
24	2d9n:A	77	36	0.1667	0.1688	0.3611	1.2	2rhk:C
25	2d9n:A	77	25	0.1538	0.1558	0.4800	1.3	2rhk:C
26	5elh:A	142	36	0.1667	0.0915	0.3611	2.0	5elh:B
27	4y3o:B	461	42	0.1667	0.0282	0.3095	3.0	4cck:A, 4cck:B, 4cck:C, 4cck:D, 4ccm:A, 4ccm:B, 4ccn:A, 4ccn:B, 4cco:A, 4cco:B, 4diq:A, 4diq:B, 4e4h:A, 4e4h:B, 4e4h:C, 4e4h:D, 4y3o:A
28	7xto:B	252	23	0.1538	0.0476	0.5217	4.9	7xto:A, 7xto:C, 7xto:D, 7xto:E, 7xto:F
29	6e20:B	133	45	0.1795	0.1053	0.3111	8.2	6e20:A
30	3sxp:D	314	13	0.1154	0.0287	0.6923	9.0	3sxp:A, 3sxp:B, 3sxp:C, 3sxp:E
31	5br7:A	386	27	0.1410	0.0285	0.4074	9.5	6d2e:A, 6d2g:A, 6d99:A, 6d9a:A, 6d9b:A, 6d9c:A, 6d9d:A, 6d9e:A, 5eqf:A, 5eqf:B, 4xgk:A, 4xgk:B

[Back]