BioLiP

>protein
SAYACDIDATRYDGFNATIYEFQPGDGRLTRDPVFMSTGYLNRTQLHSITGVTDPGFSIYTPGVPTTTLYGIPNVNWENL
LLELKGYFRAEVSGDYGLSLRNIDDSAILFFGKETAFQCCNENSISNEASTDYSLFTIFRQEGDETTNLDSFTYTQYLEA
GKYYPVRTFFVNIERHAVFNFTMTLPDGTELTDFHNYIYQFGALDEEQCQA

The query sequence (length=211) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6hos:A	213	211	1.0000	0.9906	1.0000	1.60e-158	6hos:B
2	5a3l:A	209	211	0.5877	0.5933	0.5877	4.96e-85	5a3l:B, 5a3l:C, 5a3l:D, 5a3m:A, 5a3m:B, 5a3m:C, 5a3m:D
3	4gq7:A	220	214	0.2986	0.2864	0.2944	1.30e-23	4lhk:A, 4lhk:B
4	2xjp:A	258	231	0.3081	0.2519	0.2814	1.68e-22	4lhn:A, 2xjr:A, 2xjs:A, 2xjt:A, 2xju:A, 2xjv:A
5	4coy:A	232	179	0.2370	0.2155	0.2793	8.11e-12	4cou:A, 4cov:A, 4cow:A, 4coz:A
6	6y9j:A	231	190	0.2654	0.2424	0.2947	1.03e-11	4a3x:A, 4af9:A, 4afa:A, 4afb:A, 4afc:A, 4asl:A, 4d3w:A
7	6y98:A	225	136	0.2038	0.1911	0.3162	9.45e-11	4cp0:A, 4cp1:A, 4cp2:A
8	2fge:A	979	101	0.1327	0.0286	0.2772	0.17	2fge:B
9	5g09:D	473	56	0.0806	0.0359	0.3036	5.9	5g09:A, 5g09:B, 5g09:C, 5g0a:A, 5g0a:B, 5g0a:C, 5g0a:D, 5g2p:A, 5g2p:B, 5g2p:C, 5g2p:D, 5g2q:A, 5g2q:B, 5g2q:C, 5g2q:D, 5g2q:E, 5g2q:F, 5g2q:G, 5g2q:H, 5g2q:I, 5g2q:J, 5g2q:K, 5g2q:L

[Back]