BioLiP

>protein
SAVNQENERLMEEYERLASELLEWIRRTIPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQLEINFNTLQTKL
RISNRPAFMPSEGKMVSDIAGAWQRLEQAEKGYEEWLLNEIRRLERLEHLAEKFRQKASTHETWAYGKEQILLQKDYESA
SLTEVRALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAVNVNDRCQKICDQWDRLGTLTQKRREALERMEKLLE
TIDQLHLEFAKRAAPFNNWMEGAMEDLQDMFIVHSIEEIQSLITAHEQFKATLPEADGERQSIMAIQNEVEKVIQSYNIR
ISSSNPYSTVTMDELRTKWDKVKQLVPIRDQSLQEELARQHANERLRRQFAAQANAIGPWIQNKMEEIARSSIQITGALE
DQMNQLKQYEHNIINYKNNIDKLEGDHQLIQEALVFDNKHTNYTMEHIRVGWELLLTTIARTINEVETQILTRD

The query sequence (length=474) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7a8u:A	474	474	1.0000	1.0000	1.0000	0.0
2	1g8x:A	1009	239	0.1456	0.0684	0.2887	2.13e-21	1g8x:B
3	1g8x:A	1009	122	0.0633	0.0297	0.2459	0.092	1g8x:B
4	5i4e:A	959	205	0.1266	0.0626	0.2927	5.56e-18
5	5i4e:A	959	121	0.0612	0.0302	0.2397	0.22
6	6sl2:A	619	115	0.0570	0.0436	0.2348	7.81e-04	5nl7:A, 6sl3:A
7	4q6w:A	376	74	0.0506	0.0638	0.3243	0.11	4q6w:B
8	3j5s:D	554	95	0.0675	0.0578	0.3368	1.1
9	7wm6:A	240	32	0.0338	0.0667	0.5000	4.0	7wm6:C, 7wm6:D
10	4wpc:B	288	184	0.0886	0.1458	0.2283	4.7	4wpc:A
11	3uul:A	115	99	0.0485	0.2000	0.2323	7.5
12	2r02:A	697	36	0.0338	0.0230	0.4444	8.3	3c3o:A, 3c3q:A, 3c3r:A, 2r03:A, 2r05:A, 5v3r:A, 5wa1:A, 2xs1:A, 2xs8:A
13	7jh6:A	174	76	0.0464	0.1264	0.2895	8.5	7jh6:B, 7jh6:C, 7jh6:D
14	7pt4:B	584	89	0.0443	0.0360	0.2360	9.7	7pt1:A, 7pt1:B, 7pt2:A, 7pt2:B, 7pt3:A, 7pt3:B, 7pt4:A

[Back]