SAVLSAYNQQGDPTMYEEYYSGLKHFIECSLDCHRAELSQLFYPLFVHMYLELVYNQHENEAKSFFEKFHGDQECYYQDD
LRVLSSLTKKEHMKGNETMLDFRTSKFVLRISRDSYQLLKRHLQEKQNNQIWNIVQEHLYIDIFD
The query sequence (length=145) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2nxp:A | 149 | 145 | 1.0000 | 0.9732 | 1.0000 | 1.45e-107 | 2nxp:B, 2nxp:C, 2nxp:D, 2nxp:E, 2nxp:F, 2nxp:G, 2nxp:H |
2 | 6d97:A | 522 | 39 | 0.1103 | 0.0307 | 0.4103 | 1.1 | 6d97:B, 6d97:C, 6d97:D |
3 | 8e0f:B | 454 | 37 | 0.0828 | 0.0264 | 0.3243 | 2.4 | 6d06:A, 6d06:D, 8e0f:A, 8e4x:A, 8e4x:B, 5ed1:A, 5ed1:D, 5ed2:A, 5ed2:D, 5hp2:A, 5hp2:D, 5hp3:A, 5hp3:D, 7kfn:A, 7kfn:D, 2l2k:B, 6vff:A, 6vff:B, 1zy7:A, 1zy7:B |
4 | 7nra:BBB | 328 | 50 | 0.1103 | 0.0488 | 0.3200 | 3.8 | 7nra:AAA |