SAVGEKMLDDFEGVLNWGSYSGEGAKVSTKIVSGKTGNGMEVSYTGTTDGYWGTVYSLPDGDWSKWLKISFDIKSVGSAN
EIRFMIAEKSINGVGDGEHWVYSITPDSSWKTIEIPFSSFRRRLDYQPPGQDMSGTLDLDNIDSIHFMYANNKSGKFVVD
NIKLIGALEHHHHHH
The query sequence (length=175) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6r3m:A | 175 | 175 | 1.0000 | 1.0000 | 1.0000 | 1.87e-128 | 2lro:A, 2lrp:A, 6r31:A, 1v0a:A |
2 | 6rqa:A | 322 | 46 | 0.0857 | 0.0466 | 0.3261 | 0.24 | 6rqa:B |
3 | 6dcq:M | 135 | 60 | 0.1029 | 0.1333 | 0.3000 | 0.54 | 6dcq:H, 5fuu:M, 5fuu:H, 6mar:H, 6mar:M, 6olp:G, 6olp:H, 6vpx:P |
4 | 6fxj:A | 251 | 59 | 0.0971 | 0.0677 | 0.2881 | 1.7 | 6fxj:B, 6fxj:C, 6fxj:D, 6fxj:E, 6fxq:A, 6fxq:B, 6fxq:C, 6fxq:D, 6fxq:E, 5loq:A, 5loq:B, 5loq:C, 5loq:D, 5loq:E |
5 | 6z2w:E | 2325 | 26 | 0.0629 | 0.0047 | 0.4231 | 2.4 | 6z2w:F, 6z2x:E, 6z2x:F, 6z3a:F, 6z3a:E |
6 | 8acs:A | 598 | 63 | 0.1086 | 0.0318 | 0.3016 | 2.5 | 8acs:B, 8acs:C, 8acs:D |
7 | 5yc1:F | 164 | 38 | 0.0571 | 0.0610 | 0.2632 | 3.8 | 5yc1:D, 5yc1:A |
8 | 8qoy:A | 1036 | 28 | 0.0686 | 0.0116 | 0.4286 | 4.0 | |
9 | 4z6k:A | 345 | 73 | 0.1086 | 0.0551 | 0.2603 | 6.4 | 4z6k:B, 4z6k:C, 4z6k:D |
10 | 3axx:B | 379 | 60 | 0.1086 | 0.0501 | 0.3167 | 6.4 | 3axx:A, 3axx:C, 3qhm:A, 3qhm:B, 3qhm:C, 3qhn:A, 3qhn:B, 3qhn:C, 3qho:A, 3qho:B, 3qho:C, 3vvg:A, 3vvg:C, 2zum:A, 2zun:A, 2zun:B, 2zun:C |
11 | 7oex:A | 192 | 32 | 0.0743 | 0.0677 | 0.4062 | 6.4 | 7oex:B |
12 | 8pcx:A | 232 | 50 | 0.1029 | 0.0776 | 0.3600 | 7.0 | 8bjo:A, 8bxz:A, 8p6o:A, 8pc3:A, 8pc8:A, 8pdt:A, 8ped:A, 8qli:A, 8r43:A, 8rbn:A |
13 | 7tl7:A | 531 | 19 | 0.0629 | 0.0207 | 0.5789 | 7.3 | 5kgl:A, 5kgl:B, 5kgm:A, 5kgm:B, 5kgn:A, 5kgn:B, 7knf:A, 7knf:B, 7kng:A, 7kng:B, 7tl7:B, 7tl7:C, 7tl7:D |
14 | 8cg6:A | 1208 | 27 | 0.0571 | 0.0083 | 0.3704 | 7.5 | |
15 | 4yu6:A | 754 | 88 | 0.1257 | 0.0292 | 0.2500 | 7.5 | 4yu5:A, 4yu5:B, 4yu6:B |
16 | 5d84:A | 318 | 57 | 0.1029 | 0.0566 | 0.3158 | 7.8 | 5d85:A, 5d86:A, 5d87:A |
17 | 8cg5:A | 1282 | 27 | 0.0571 | 0.0078 | 0.3704 | 8.1 | 6fij:B |
18 | 8qcf:K | 915 | 53 | 0.0914 | 0.0175 | 0.3019 | 8.3 |