SATRWLPFVSSDLKDYLNRYWAVMFTVGARPIETGHIRHYVSWYCTRMKVVLLDHHVYVEPLRQQLQEASRTPELPLLFV
NKKLVGTLRDVELLEREKKLKDVLHFGFEWRVGGSVAATNGQKSLMGALPAPYGDAEFFRGRYRGPPVARPVVSLPTLHP
FAL
The query sequence (length=163) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6sga:Fa | 163 | 163 | 1.0000 | 1.0000 | 1.0000 | 2.36e-120 | 6sg9:Fa, 6sgb:Fa |
2 | 3uiw:A | 110 | 91 | 0.1411 | 0.2091 | 0.2527 | 0.025 | 3uiw:B |
3 | 4n11:A | 108 | 75 | 0.1288 | 0.1944 | 0.2800 | 0.073 | 7din:A, 7dio:A, 7dip:A, 7diq:A |
4 | 3d5j:A | 112 | 55 | 0.0982 | 0.1429 | 0.2909 | 0.17 | 3d5j:B |
5 | 4oua:B | 557 | 48 | 0.1227 | 0.0359 | 0.4167 | 0.49 | 5m6b:B, 5m6b:A, 5m6b:D, 4oua:A |
6 | 2ht9:B | 111 | 57 | 0.1104 | 0.1622 | 0.3158 | 1.9 | 2fls:A, 2ht9:A |
7 | 5m6b:C | 514 | 33 | 0.0920 | 0.0292 | 0.4545 | 3.8 |