BioLiP

>protein
SASVIFSKYINNNNNKLIPFKIKNSDLGRTRYFPPISKEWKNSIYVFNHNNLKNLPLFDININSLIKDYFNLQFKDKILF
KKKRLSKVKVVSLNKIYASKAEIKHTNTKAILTVYTFNREKISLYKKIKKLKKSFYFVFDKIISFSERVILSGVPVLPWI
TESHVNIWRKIIIASLYKELILLRKYKLRLDLNKYKFEEKLLYRLNNLIMKYYNKKVEFNIVNMRSFLLNSDILTKILAL
KLKNRNARVIKIMDVILNKANLPKINRVQEKASLIKSVDWNLLENKFKNLNLSFILNDASYAERNNLSELLNKLYYNVLL
VSQKGVWALRSPAQPKVSSFAKAKKYAKIYQIIFNSINYKNMGGLRLEIKGRLTKRYRADRSLFKVKWKGGLKNLDSSYK
GLSSVNMRGYAKPNVEYSIFTSKRRIGAFAVKGWVSGK

The query sequence (length=438) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6yw5:CC	438	438	1.0000	1.0000	1.0000	0.0	6ywe:CC, 6ywx:CC, 6ywy:CC
2	8ihn:K	598	145	0.0799	0.0585	0.2414	0.21	8iht:K
3	8hxx:K	549	145	0.0799	0.0638	0.2414	0.27	8hxy:K, 8hy0:K, 8jho:K, 8kd3:B, 8kd4:B, 8kd5:B, 8kd6:B, 8tof:A
4	1ep1:B	261	74	0.0479	0.0805	0.2838	0.28	1ep2:B, 1ep3:B
5	7yi2:A	506	145	0.0799	0.0692	0.2414	0.43	7yi5:A
6	2enx:A	310	93	0.0525	0.0742	0.2473	0.69	2enx:B
7	7agj:A	731	27	0.0297	0.0178	0.4815	5.4	7agj:B
8	5ksw:B	262	74	0.0434	0.0725	0.2568	5.4	5ksw:D, 5ue9:B, 5ue9:D
9	8phi:F	453	140	0.0753	0.0728	0.2357	7.1	9bjm:A, 5ea3:F, 5ea4:F, 5ea5:F, 5ea6:F, 6eag:F, 6eah:C, 6eak:F, 8kg5:A, 8kg5:C, 8kg5:B, 3kpe:A, 7kqd:F, 5kww:F, 6ntx:B, 6vkc:F, 6vkd:F, 6vke:F
10	8w4g:A	876	84	0.0457	0.0228	0.2381	8.7	8w4i:A, 8w4n:A, 8x8g:A

[Back]