BioLiP

>protein
SAQDWHRADIVAALHKRGITLAGLSRAHGLAARTLSNAMERHYPRAERLIAQALDMRPEDIWPQRYRN

The query sequence (length=68) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7f9h:A	76	68	1.0000	0.8947	1.0000	1.30e-45	7f9h:B
2	6z2w:E	2325	46	0.2500	0.0073	0.3696	0.93	6z2w:F, 6z2x:E, 6z2x:F, 6z3a:F, 6z3a:E
3	8tua:A	1329	62	0.2794	0.0143	0.3065	2.4	5d3x:A, 5d3x:B, 5d3y:A, 5d3y:B, 5fi0:A, 5fi0:C, 5fi0:E, 5fi0:G
4	6za0:A	240	52	0.2647	0.0750	0.3462	2.7	6z74:A, 6z74:B, 6z74:C, 6z74:D, 6za0:B, 6za3:A, 6za3:B, 6za7:A, 6za7:B, 6za7:C, 6za7:D, 6zab:A
5	3kfu:F	447	37	0.2059	0.0313	0.3784	3.7	3kfu:I
6	5eqx:A	439	41	0.2059	0.0319	0.3415	5.3
7	6vwp:A	435	64	0.2353	0.0368	0.2500	6.1	6vwo:A, 6vwp:B, 6vwp:C, 6vwp:D, 6vwp:E, 6vwp:F, 6vwp:G, 6vwp:H
8	8owr:B	229	51	0.2206	0.0655	0.2941	6.2	6th2:B, 6th2:D
9	3h70:A	342	31	0.2059	0.0409	0.4516	7.2
10	7qcd:C	267	28	0.1618	0.0412	0.3929	7.4	3htk:C
11	1onx:A	389	39	0.1618	0.0283	0.2821	7.9	2aqo:A, 2aqo:B, 2aqv:A, 2aqv:B, 1onw:A, 1onw:B, 1onx:B, 1po9:A, 1po9:B, 1poj:A, 1poj:B, 1pok:B, 1pok:A, 1ybq:A, 1ybq:B
12	6zxu:A	701	42	0.2353	0.0228	0.3810	8.1	4ras:A, 4ras:B, 4ras:C, 6zxu:B, 6zxu:C, 6zxx:A, 6zxx:B, 6zxx:C, 6zy0:A, 6zy0:B, 6zy0:C, 6zy1:A, 6zy1:B, 6zy1:C

[Back]