SAMMYIQELRSGLRDMHLLSCLESLRVSLNNNPVSWVQTFGAEGLASLLDILKRLHDEKNYDSRNQHEIIRCLKAFMNNK
FGIKTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLDGLKSGTSI
ALKVGCLQLINALITPAEELDFRVHIRSELMRLGLHQVLQELREIENEDMKVQLCVFDEQGDEDFFDLKG
The query sequence (length=230) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3obv:D | 327 | 235 | 1.0000 | 0.7034 | 0.9787 | 2.46e-166 | 2bap:B, 2bap:A, 2f31:A, 8fg1:A, 3obv:A, 3obv:B, 3obv:C, 4uwx:A, 4uwx:B |
2 | 5zi5:A | 850 | 83 | 0.0957 | 0.0259 | 0.2651 | 0.27 | 5zi5:B, 5zi7:A, 5zi7:B, 5zie:A, 5zie:B |
3 | 4awd:A | 297 | 23 | 0.0435 | 0.0337 | 0.4348 | 0.38 | 4awd:B |
4 | 2k4i:A | 134 | 44 | 0.0522 | 0.0896 | 0.2727 | 1.1 | |
5 | 8gzh:Z | 1217 | 52 | 0.0913 | 0.0173 | 0.4038 | 2.5 | |
6 | 8gzg:Z | 1175 | 52 | 0.0913 | 0.0179 | 0.4038 | 2.7 | |
7 | 7cqt:A | 450 | 74 | 0.0870 | 0.0444 | 0.2703 | 2.8 | 7cqt:B, 7cqt:C, 2fa0:A, 2fa3:A |
8 | 2f9a:A | 404 | 71 | 0.0826 | 0.0470 | 0.2676 | 2.8 | |
9 | 6sbq:A | 891 | 44 | 0.0609 | 0.0157 | 0.3182 | 4.3 | 6ea1:A, 6ea2:A, 6eaa:A, 6eab:A, 3ebg:A, 3ebh:A, 3ebi:A, 6ee3:A, 6ee4:A, 6ee6:A, 6eed:A, 8ewz:A, 8ex3:A, 8eyd:A, 8eye:A, 8eyf:A, 8ez2:A, 4j3b:A, 4k5l:A, 4k5m:A, 4k5n:A, 4k5o:A, 4k5p:A, 3q43:A, 3q44:A, 4r5t:A, 4r5v:A, 4r5x:A, 6sbr:A, 8slo:A, 8svl:A, 8t6h:A, 8t7p:A, 3t8v:A, 8t83:A, 4x2u:A, 5xm7:A, 5y19:A, 5y1h:A, 5y1k:A, 5y1q:A, 5y1r:A, 5y1s:A, 5y1t:A, 5y1v:A, 5y1w:A, 5y1x:A, 5y3i:A, 4zqt:A, 4zw3:A, 4zw5:A, 4zw6:A, 4zw7:A, 4zw8:A, 4zx3:A, 4zx4:A, 4zx5:A, 4zx6:A |
10 | 6nd4:b | 425 | 61 | 0.0826 | 0.0447 | 0.3115 | 4.7 | 5wlc:SB |
11 | 7aju:CE | 436 | 61 | 0.0826 | 0.0436 | 0.3115 | 5.1 | 7ajt:CE, 7d4i:3E, 7d5s:3E, 7d5t:3E, 7d63:3E, 6ke6:3E, 6lqp:3E, 6lqq:3E, 6lqr:3E, 6lqs:3E, 6lqt:3E, 6lqu:3E, 6lqv:3E, 7suk:SB, 5wyj:3E, 5wyk:3E, 6zqa:CE, 6zqb:CE, 6zqc:CE, 6zqd:CE, 6zqe:CE |