SAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNSSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLD
GNKTMIELSDNENPWTIFLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCDR
AGFIQDTSLILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDVIFCDKTI
PNDPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQFFKSQGPGNPLRHNYEGTLRDLLQFFKPQPKKLYYQQL
The query sequence (length=313) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5c56:A | 528 | 322 | 0.9968 | 0.5909 | 0.9689 | 0.0 | 5c6d:A, 5c6d:B, 5gg4:A, 5gg4:B, 5gg4:C, 5gg4:D, 6p5l:A, 4wph:B, 4wph:A, 4wpi:B, 4wpi:A, 7xpy:A, 4z96:A, 4z97:A |
2 | 6g1t:A | 115 | 58 | 0.0671 | 0.1826 | 0.3621 | 0.67 | |
3 | 7ec3:A | 500 | 153 | 0.1150 | 0.0720 | 0.2353 | 2.9 | 7ec3:C, 7ec6:A, 7ec7:A, 7ec7:B, 7vfl:A, 7vfl:C, 7vfm:A, 7vfm:C, 7vfn:A, 7vfo:A, 7vfo:B |
4 | 3fz9:A | 106 | 47 | 0.0479 | 0.1415 | 0.3191 | 3.1 | 3fza:A |
5 | 2a3l:A | 616 | 39 | 0.0447 | 0.0227 | 0.3590 | 6.1 |