Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
SAFDRDFGYLMPFLDRVAAAASDLEDASARAELTRLMVEEKARWQRIQELL

The query sequence (length=51) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 8vjn:A 52 51 1.0000 0.9808 1.0000 6.08e-31 8vjn:C, 8vjn:B, 8vjn:D
2 6sg9:DH 472 29 0.2353 0.0254 0.4138 0.33 6sgb:DH
3 6s1m:A 1010 23 0.1961 0.0099 0.4348 2.2 6s1n:A, 6s1o:A, 6tny:A, 6tnz:A
4 7nrr:AAA 329 29 0.2157 0.0334 0.3793 4.2 7nrr:BBB, 7nsw:AAA, 7nsw:BBB, 7ntd:AAA, 7ntd:BBB, 7nte:A, 7nte:B
5 8jij:A 411 10 0.1373 0.0170 0.7000 5.6 8jik:A
6 5oas:A 728 60 0.3137 0.0220 0.2667 6.4 5vfb:A, 5vfb:B
7 8xfc:D 517 38 0.2549 0.0251 0.3421 7.1 8wdb:D
8 3guw:A 233 45 0.2745 0.0601 0.3111 7.8 3guw:B, 3guw:C, 3guw:D
9 5whs:A 713 42 0.2549 0.0182 0.3095 8.4 5whq:A, 5whq:B, 5whs:B

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218