RYRLFHPRREAIPMHMCPAKTIFPLINSNNLLVKTRNSWEDFTGRKEFDEDHPLPVVGSRLNGRTTQHKWNHWDQYLNPQ
ITQSIKDLTPTPEYVGMRCGHNMIKMGWMKIGGSWKYSRGYNDRRRVRFMLAPRVSAGGPRNRYEGKLVFSPLRLSKLLW
AIDTGRINPNEVITLYHLRQANVVGEREIVWPGFVLISNGVRRVPYPIHIELQNASAESIRLIEEAGGSFTCVYMTHEGL
YQELHPEEYPIFMDQELPERRGLESLATNPSKRGWLTRWYEDSSKYAHPAAGRRYSHYLKPPTERDFPATVEEYEMVKHH
QKWHLNQPGTGTLLPWHSYNTADLVKRAAGRL
The query sequence (length=352) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6hiv:AP | 352 | 352 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 7aoi:AP, 6hix:AP, 6yxx:AP, 6yxy:AP |
2 | 7aih:G | 365 | 365 | 0.7443 | 0.7178 | 0.7178 | 0.0 | 7am2:G, 7ane:G |
3 | 6z1p:Aq | 273 | 138 | 0.1136 | 0.1465 | 0.2899 | 9.58e-14 | |
4 | 6xyw:Al | 180 | 109 | 0.0966 | 0.1889 | 0.3119 | 1.03e-11 | |
5 | 8a22:Aj | 206 | 112 | 0.1023 | 0.1748 | 0.3214 | 2.41e-07 | 8apn:Aj, 8apo:Aj |
6 | 7po4:M | 269 | 162 | 0.1335 | 0.1747 | 0.2901 | 4.08e-07 | 7oi6:M |
7 | 7odr:M | 291 | 162 | 0.1335 | 0.1615 | 0.2901 | 4.40e-07 | 7a5f:M3, 7a5g:M3, 7a5h:M, 7a5i:M3, 7a5j:M, 7a5k:M3, 5aj4:BP, 8any:M, 6gaw:BP, 6gb2:BP, 6i9r:M, 3j7y:M, 3j9m:M, 8k2a:LO, 8k2b:LO, 7l08:M, 7l20:M, 7nqh:BP, 7nql:BP, 7nsh:BP, 7nsi:BP, 7nsj:BP, 6nu2:M, 6nu3:M, 7o9k:M, 7o9m:M, 7ods:M, 7odt:M, 7of0:M, 7of2:M, 7of3:M, 7of4:M, 7of5:M, 7of6:M, 7of7:M, 7og4:XM, 7oi7:M, 7oi8:M, 7oi9:M, 7oia:M, 7oib:M, 7oic:M, 7oid:M, 7oie:M, 8oin:BT, 8oiq:BT, 8oir:BT, 8oit:BT, 5ool:M, 5oom:M, 7pd3:M, 8pk0:M, 7qh6:M, 7qh7:M, 7qi4:M, 7qi5:M, 7qi6:M, 8qsj:M, 8qu1:M, 8qu5:M, 4v19:P, 6vlz:M, 6vmi:M, 8xt0:LO, 8xt1:LO, 8xt2:LO, 8xt3:LO, 6ydp:BP, 6ydw:BP, 6zm5:M, 6zm6:M, 6zs9:XM, 6zsa:XM, 6zsb:XM, 6zsc:XM, 6zsd:XM, 6zse:XM, 6zsg:XM |
8 | 7pkt:k | 210 | 118 | 0.0966 | 0.1619 | 0.2881 | 3.77e-06 | |
9 | 4ce4:P | 169 | 89 | 0.0824 | 0.1716 | 0.3258 | 9.08e-06 | |
10 | 3j6b:J | 220 | 123 | 0.1136 | 0.1818 | 0.3252 | 2.46e-04 | 5mrc:J, 5mre:J, 5mrf:J |
11 | 6ywe:J | 243 | 109 | 0.0966 | 0.1399 | 0.3119 | 0.013 | 6yws:J, 6ywv:J, 6ywx:J, 6ywy:J |
12 | 4cns:D | 479 | 59 | 0.0483 | 0.0355 | 0.2881 | 1.6 | 4cns:A, 4cns:B, 4cns:C |
13 | 6bum:B | 363 | 32 | 0.0341 | 0.0331 | 0.3750 | 2.2 | 6bum:A, 6bum:C, 6bum:D, 6bun:A, 6bun:B, 6bun:C, 6bun:D, 6buo:A, 6buo:D, 6buo:B, 6buo:C, 6bup:A, 6bup:B, 6bup:C, 6bup:D, 6buq:A, 6buq:D, 6buq:B, 6buq:C, 6bur:A, 6bur:B, 6bur:C, 6bur:D, 6cwj:A, 6cwj:B, 6cwj:C, 6cwj:D |
14 | 7rtm:A | 571 | 38 | 0.0398 | 0.0245 | 0.3684 | 2.7 | 7rtm:B |
15 | 8fok:1 | 1046 | 110 | 0.0710 | 0.0239 | 0.2273 | 3.8 | 3flo:B, 3flo:D, 3flo:F, 3flo:H, 4fxd:A, 4fxd:B, 4fyd:A, 4fyd:B |
16 | 7f3w:D | 440 | 61 | 0.0455 | 0.0364 | 0.2623 | 9.6 |