RYMRMILMFDMPTDTAEERKAYRKFRKFLLSEGFIMHQFSVYSKLLLNHTANTAMVGRLKANNPKKGNITILTVTEKQFA
RMIYLYGDKNTSIANSEERLVFLGDNYC
The query sequence (length=108) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8q2n:D | 108 | 108 | 1.0000 | 1.0000 | 1.0000 | 1.84e-78 | 8pk1:A, 8pk1:D, 8q2n:A |
2 | 5xvn:F | 108 | 105 | 0.7130 | 0.7130 | 0.7333 | 3.18e-57 | 5xvn:E, 5xvn:M, 5xvn:N, 5xvo:E, 5xvo:F, 5xvo:M, 5xvo:N, 5xvp:E, 5xvp:F |
3 | 8ia4:B | 92 | 89 | 0.3981 | 0.4674 | 0.4831 | 1.26e-25 | |
4 | 8au6:A | 248 | 35 | 0.1019 | 0.0444 | 0.3143 | 3.8 | |
5 | 4q9n:A | 295 | 85 | 0.1667 | 0.0610 | 0.2118 | 5.8 | 4q9n:B, 4q9n:C, 4q9n:D, 4q9n:E, 4q9n:F, 4q9n:G, 4q9n:H |
6 | 3lvt:A | 833 | 91 | 0.1944 | 0.0252 | 0.2308 | 7.4 | |
7 | 6yxx:ES | 152 | 58 | 0.1389 | 0.0987 | 0.2586 | 9.6 | 6yxy:ES |