BioLiP

>protein
RWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKHGWQIERELDEG

The query sequence (length=46) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7dvq:M	191	46	1.0000	0.2408	1.0000	1.22e-29	8i0r:K, 8i0s:K, 8i0t:K, 5z56:M, 5z58:M
2	6ff4:t	172	45	0.9783	0.2616	1.0000	5.34e-29	8ch6:Z, 6ff7:t, 7qtt:Z
3	7dco:M	176	41	0.5870	0.1534	0.6585	1.85e-17	5gm6:a
4	1m9o:A	40	25	0.2174	0.2500	0.4000	0.002
5	1rgo:A	70	26	0.1957	0.1286	0.3462	0.006
6	1rgo:A	70	25	0.1957	0.1286	0.3600	0.014
7	5elh:A	142	29	0.3261	0.1056	0.5172	0.031	5elh:B
8	7k95:A	53	23	0.2826	0.2453	0.5652	0.060	7zyh:A, 7zyh:D, 7zyh:G, 7zyh:J
9	6pmg:X	35	27	0.2391	0.3143	0.4074	0.075
10	6nzl:A	78	25	0.1957	0.1154	0.3600	0.16
11	6nzl:A	78	29	0.2174	0.1282	0.3448	0.24
12	8y6o:V	101	36	0.2826	0.1287	0.3611	0.63
13	2cqe:A	98	21	0.2609	0.1224	0.5714	0.93
14	2cqe:A	98	22	0.1957	0.0918	0.4091	8.5
15	2d9m:A	69	36	0.3043	0.2029	0.3889	1.7
16	6uej:A	212	25	0.2174	0.0472	0.4000	2.1	6uei:A
17	3u9g:A	217	28	0.2609	0.0553	0.4286	2.8	6l1w:A
18	8pj1:s	159	16	0.1957	0.0566	0.5625	2.9	7a09:4, 8oz0:U, 8ppl:Is, 7qp6:s, 6ybv:s, 6zmw:s, 6zp4:4
19	2fc6:A	50	30	0.2174	0.2000	0.3333	3.4
20	1w66:A	218	12	0.1522	0.0321	0.5833	3.7
21	3r4i:A	321	15	0.1522	0.0218	0.4667	3.7	3r4i:B, 3r4i:C, 3r4i:D, 3r4i:E, 3r4i:F
22	6fdz:U	265	28	0.2391	0.0415	0.3929	4.7	6fdy:U
23	2x7k:A	164	25	0.1739	0.0488	0.3200	5.0
24	4zw2:A	319	21	0.1957	0.0282	0.4286	6.5
25	1vyt:A	273	21	0.1957	0.0330	0.4286	6.5
26	1vyt:B	294	21	0.1957	0.0306	0.4286	6.5
27	4izg:A	369	23	0.1522	0.0190	0.3043	7.4	4e8g:A, 4e8g:B, 4izg:B, 4j1o:A, 4j1o:B

[Back]