RWATPGHEERPKGYFMNRTPPAPGQSRKWEDWELPCYITSFLTIVILGVGLNAKPDLSIETWAHQKALERLEMEK
The query sequence (length=75) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8beh:g | 79 | 75 | 1.0000 | 0.9494 | 1.0000 | 5.08e-53 | 7aqw:g |
2 | 7l56:F | 129 | 23 | 0.1333 | 0.0775 | 0.4348 | 6.9 | 7l56:H |
3 | 2djr:A | 76 | 38 | 0.1467 | 0.1447 | 0.2895 | 8.5 | |
4 | 8uw3:A | 1265 | 41 | 0.1733 | 0.0103 | 0.3171 | 9.8 | 7n8s:A, 7n94:A, 7n94:B, 8sp5:A, 8sp5:B, 8sp7:A, 8sxt:A, 8sxu:A, 1vyb:B |